Protein Folding with Pyrosetta

In this tutorial, we will fold a protein structure using a very simple algorithm in PyRosetta, and compare the folded structure with the solved crystal structure of the protein.

Importing relevant libraries

We begin by importing the relevant libraries from Python. If running the following cell produces any errors or warnings, make sure you have followed all the steps in the "Setting up Pyrosetta" section.

In [6]:
import os
import glob
import shutil
import numpy as np
import pandas as pd
import nglview as ngl
import pyrosetta as prs
prs.init()
from pyrosetta import rosetta

PyRosetta-4 2020 [Rosetta PyRosetta4.conda.linux.CentOS.python37.Release 2020.08+release.cb1cabafd7463ab703f6abf5efa33d2707b85924 2020-02-20T07:29:09] retrieved from: http://www.pyrosetta.org
(C) Copyright Rosetta Commons Member Institutions. Created in JHU by Sergey Lyskov and PyRosetta Team.
core.init: {0} Checking for fconfig files in pwd and ./rosetta/flags
core.init: {0} Rosetta version: PyRosetta4.conda.linux.CentOS.python37.Release r247 2020.08+release.cb1caba cb1cabafd7463ab703f6abf5efa33d2707b85924 http://www.pyrosetta.org 2020-02-20T07:29:09
core.init: {0} command: PyRosetta -ex1 -ex2aro -database /home/perry/miniconda3/envs/my_env/lib/python3.7/site-packages/pyrosetta/database
basic.random.init_random_generator: {0} 'RNG device' seed mode, using '/dev/urandom', seed=-996830844 seed_offset=0 real_seed=-996830844 thread_index=0
basic.random.init_random_generator: {0} RandomGenerator:init: Normal mode, seed=-996830844 RG_type=mt19937

Setting up score functions that will be used across parts

In [3]:
scorefxn_low = prs.create_score_function('score3')
scorefxn_high = prs.get_fa_scorefxn()

basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/env_log.txt
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/cbeta_den.txt
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/pair_log.txt
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/cenpack_log.txt
basic.io.database: {0} Database file opened: scoring/score_functions/SecondaryStructurePotential/phi.theta.36.HS.resmooth
basic.io.database: {0} Database file opened: scoring/score_functions/SecondaryStructurePotential/phi.theta.36.SS.resmooth
core.scoring.ScoreFunctionFactory: {0} SCOREFUNCTION: ref2015
core.scoring.etable: {0} Starting energy table calculation
core.scoring.etable: {0} smooth_etable: changing atr/rep split to bottom of energy well
core.scoring.etable: {0} smooth_etable: spline smoothing lj etables (maxdis = 6)
core.scoring.etable: {0} smooth_etable: spline smoothing solvation etables (max_dis = 6)
core.scoring.etable: {0} Finished calculating energy tables.
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/HBPoly1D.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/HBFadeIntervals.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/HBEval.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/DonStrength.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/AccStrength.csv
core.chemical.GlobalResidueTypeSet: {0} Finished initializing fa_standard residue type set.  Created 980 residue types
core.chemical.GlobalResidueTypeSet: {0} Total time to initialize 1.44822 seconds.
basic.io.database: {0} Database file opened: scoring/score_functions/rama/fd/all.ramaProb
basic.io.database: {0} Database file opened: scoring/score_functions/rama/fd/prepro.ramaProb
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.all.txt
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.gly.txt
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.pro.txt
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.valile.txt
basic.io.database: {0} Database file opened: scoring/score_functions/P_AA_pp/P_AA
basic.io.database: {0} Database file opened: scoring/score_functions/P_AA_pp/P_AA_n
core.scoring.P_AA: {0} shapovalov_lib::shap_p_aa_pp_smooth_level of 1( aka low_smooth ) got activated.
basic.io.database: {0} Database file opened: scoring/score_functions/P_AA_pp/shapovalov/10deg/kappa131/a20.prop

Loading the native (solved crystal) structure

In [4]:
native_pose = prs.pose_from_pdb('data/1BL0/1BL0_chainA.pdb')

core.import_pose.import_pose: {0} File 'data/1BL0/1BL0_chainA.pdb' automatically determined to be of type PDB
In [7]:
# generate a random aa sequence with the same aa distribution
N = 50

# taken from https://web.expasy.org/protscale/pscale/A.A.Swiss-Prot.html
aa_freqs = {
    'A':  8.25,  
    'R':  5.53,
    'N':  4.06, 
    'D':  5.45, 
    'C':  1.37, 
    'Q':  3.93, 
    'E':  6.75, 
    'G':  7.07, 
    'H':  2.27, 
    'I':  5.96, 
    'L':  9.66, 
    'K':  5.84, 
    'M':  2.42, 
    'F':  3.86, 
    'P':  4.70, 
    'S':  6.56, 
    'T':  5.34, 
    'W':  1.08, 
    'Y':  2.92, 
    'V':  6.87
}

s = ""
for aa, freq in aa_freqs.items():
    for i in range(int(freq * 20)):
        s += aa

sequence = ""
indices = np.random.randint(0, len(s) - 1, N)
for idx in indices:
    sequence += s[idx]
    
print(sequence)

STDTLRKKNAGLETAALNHGGDHTTVALVNFHGNRGALIENLKGAEMSQS

We can check the amino acid sequence of the structure with a very simple command.

In [8]:
native_pose.sequence()
Out[8]:
'DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL'

We can also assign the correct secondary structure.

In [9]:
DSSP = prs.rosetta.protocols.moves.DsspMover()
DSSP.apply(native_pose)    # populates the pose's Pose.secstruct

protocols.DsspMover: {0} LHHHHHHHHHHHHLLLLLLLLLHHHHHHLLLLHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHHHLLLLHHHHHHHHLLLLHHHHHHHHHHHHLLLHHHHHLLLLLLLLLLLLLL

Hint: The amino acids are also called residues!

Let's view more information about the first residue of the protein.

In [10]:
print(native_pose.residue(1))

Residue 1: ASP:NtermProteinFull (ASP, D):
Base: ASP
 Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS SC_ORBITALS POLAR CHARGED NEGATIVE_CHARGE METALBINDING ALPHA_AA L_AA
 Variant types: LOWER_TERMINUS_VARIANT
 Main-chain atoms:  N    CA   C  
 Backbone atoms:    N    CA   C    O   1H   2H   3H    HA 
 Side-chain atoms:  CB   CG   OD1  OD2 1HB  2HB 
Atom Coordinates:
   N  : 0.229, 36.012, 74.172
   CA : 0.041, 35.606, 75.594
   C  : -0.096, 36.849, 76.498
   O  : -0.951, 36.895, 77.382
   CB : 1.225, 34.718, 76.092
   CG : 2.159, 34.156, 74.999
   OD1: 1.688, 33.361, 74.151
   OD2: 3.378, 34.497, 75.007
  1H  : 1.056, 35.74, 73.68
  2H  : -0.43, 35.723, 73.478
  3H  : 0.251, 36.981, 73.928
   HA : -0.884, 35.037, 75.696
  1HB : 1.839, 35.199, 76.854
  2HB : 0.67, 33.892, 76.539
Mirrored relative to coordinates in ResidueType: FALSE
In [11]:
pose = prs.pose_from_sequence(sequence)
test_pose = prs.Pose()
test_pose.assign(pose)
test_pose.pdb_info().name('Linearized Pose')
In [ ]:
view = ngl.show_rosetta(test_pose)
view.add_ball_and_stick()
view  # zoom in to see the atoms!

Defining movers to switch from full-atom to centroid representation

We will be using the centroid representation to perform rough and fast scoring in the initial stages of the folding algorithm. Later on, we will switch to the full atom represenation to do accurate minimization and get the final structures.

In [13]:
to_centroid = prs.SwitchResidueTypeSetMover('centroid')
to_full_atom = prs.SwitchResidueTypeSetMover('fa_standard')
In [14]:
to_full_atom.apply(test_pose)
print('Full Atom Score:', scorefxn_high(test_pose))
to_centroid.apply(test_pose)
print('Centroid Score:', scorefxn_low(test_pose))

core.util.switchresiduetypeset: {0} [ WARNING ] When switching to a fa_standard ResidueTypeSet:  Pose already contains fa_standard ResidueTypes.
basic.io.database: {0} Database file opened: scoring/score_functions/elec_cp_reps.dat
core.scoring.elec.util: {0} Read 40 countpair representative atoms
core.pack.dunbrack.RotamerLibrary: {0} shapovalov_lib_fixes_enable option is true.
core.pack.dunbrack.RotamerLibrary: {0} shapovalov_lib::shap_dun10_smooth_level of 1( aka lowest_smooth ) got activated.
core.pack.dunbrack.RotamerLibrary: {0} Binary rotamer library selected: /home/perry/miniconda3/envs/my_env/lib/python3.7/site-packages/pyrosetta/database/rotamer/shapovalov/StpDwn_0-0-0/Dunbrack10.lib.bin
core.pack.dunbrack.RotamerLibrary: {0} Using Dunbrack library binary file '/home/perry/miniconda3/envs/my_env/lib/python3.7/site-packages/pyrosetta/database/rotamer/shapovalov/StpDwn_0-0-0/Dunbrack10.lib.bin'.
core.pack.dunbrack.RotamerLibrary: {0} Dunbrack 2010 library took 0.818671 seconds to load from binary
Full Atom Score: 13159.241276890436
core.chemical.GlobalResidueTypeSet: {0} Finished initializing centroid residue type set.  Created 62 residue types
core.chemical.GlobalResidueTypeSet: {0} Total time to initialize 0.048479 seconds.
Centroid Score: 208.83575008248903

Q: Visualize the centroid-only structure and see the difference with the full atom that we visualized above? Print again the information for the first residue and compare.

In [ ]:
# here write the code to visualize the centroid only structure and print the information of the 1st residue

view = ngl.show_rosetta(test_pose)
view.add_ball_and_stick()
view  # zoom in to see the atoms!
In [16]:
print(native_pose.residue(1))

print(test_pose.residue(1))

Residue 1: ASP:NtermProteinFull (ASP, D):
Base: ASP
 Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS SC_ORBITALS POLAR CHARGED NEGATIVE_CHARGE METALBINDING ALPHA_AA L_AA
 Variant types: LOWER_TERMINUS_VARIANT
 Main-chain atoms:  N    CA   C  
 Backbone atoms:    N    CA   C    O   1H   2H   3H    HA 
 Side-chain atoms:  CB   CG   OD1  OD2 1HB  2HB 
Atom Coordinates:
   N  : 0.229, 36.012, 74.172
   CA : 0.041, 35.606, 75.594
   C  : -0.096, 36.849, 76.498
   O  : -0.951, 36.895, 77.382
   CB : 1.225, 34.718, 76.092
   CG : 2.159, 34.156, 74.999
   OD1: 1.688, 33.361, 74.151
   OD2: 3.378, 34.497, 75.007
  1H  : 1.056, 35.74, 73.68
  2H  : -0.43, 35.723, 73.478
  3H  : 0.251, 36.981, 73.928
   HA : -0.884, 35.037, 75.696
  1HB : 1.839, 35.199, 76.854
  2HB : 0.67, 33.892, 76.539
Mirrored relative to coordinates in ResidueType: FALSE

Residue 1: SER:NtermProteinFull (SER, S):
Base: SER
 Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS POLAR ALPHA_AA L_AA
 Variant types: LOWER_TERMINUS_VARIANT
 Main-chain atoms:  N    CA   C  
 Backbone atoms:    N    CA   C    O    H  
 Side-chain atoms:  CB   CEN
Atom Coordinates:
   N  : 0, 0, 0
   CA : 1.458, 0, 0
   C  : 2.00885, 1.42017, 0
   O  : 1.25096, 2.39022, 0
   CB : 1.98, -0.769001, -1.198
   CEN: 2.00527, -0.962641, -1.70567
   H  : -0.5, -0.433013, -0.75
Mirrored relative to coordinates in ResidueType: FALSE

Setting up the folding algorithm

In [17]:
# Loading the files with the pre-computed fragmets
long_frag_filename = 'data/random/aat000_09_05.200_v1_3'
long_frag_length = 9
short_frag_filename = 'data/random/aat000_03_05.200_v1_3'
short_frag_length = 3

# Defining parameters of the folding algorithm
long_inserts=5  # How many 9-fragment pieces to insest during the search
short_inserts=10 # How many 3-fragment pieces to insest during the search

kT = 3.0 # Simulated Annealing temperature
cycles = 1000 # How many cycles of Monte Carlo search to run
jobs = 50 # How many trajectories in parallel to compute.
job_output = 'outputs/random/decoy' # The prefix of the filenames to store the results

Loading the fragmets

In [18]:
movemap = prs.MoveMap()
movemap.set_bb(True)

fragset_long = rosetta.core.fragment.ConstantLengthFragSet(long_frag_length, long_frag_filename)
long_frag_mover = rosetta.protocols.simple_moves.ClassicFragmentMover(fragset_long, movemap)

fragset_short = rosetta.core.fragment.ConstantLengthFragSet(short_frag_length, short_frag_filename)
short_frag_mover = rosetta.protocols.simple_moves.ClassicFragmentMover(fragset_short, movemap)

insert_long_frag = prs.RepeatMover(long_frag_mover, long_inserts)
insert_short_frag = prs.RepeatMover(short_frag_mover, short_inserts)

core.fragments.ConstantLengthFragSet: {0} finished reading top 200 9mer fragments from file data/random/aat000_09_05.200_v1_3
core.fragments.ConstantLengthFragSet: {0} finished reading top 200 3mer fragments from file data/random/aat000_03_05.200_v1_3

Q: How many 9-mer and 3-mer fragmets do we have in our database?

In [19]:
print("Number of 9mers: ", fragset_long.size())
print("Number of 3mers: ", fragset_short.size())

Number of 9mers:  4400
Number of 3mers:  5600
In [20]:
# Making sure the structure is in centroid-only mode for the search
test_pose.assign(pose)
to_centroid.apply(test_pose)
In [21]:
# Defining what sequence of actions to do between each scoring step
folding_mover = prs.SequenceMover()
folding_mover.add_mover(insert_long_frag)
folding_mover.add_mover(insert_short_frag)
In [22]:
mc = prs.MonteCarlo(test_pose, scorefxn_low, kT)
trial = prs.TrialMover(folding_mover, mc)
In [23]:
# Setting up how many cycles of search to do in each trajectory
folding = prs.RepeatMover(trial, cycles)

Setting up the relax mover for the final stage

In [24]:
fast_relax_mover = prs.rosetta.protocols.relax.FastRelax(scorefxn_high)

protocols.relax.RelaxScriptManager: {0} Reading relax scripts list from database.
protocols.relax.RelaxScriptManager: {0} Looking for MonomerRelax2019.txt
protocols.relax.RelaxScriptManager: {0} ================== Reading script file: /home/perry/miniconda3/envs/my_env/lib/python3.7/site-packages/pyrosetta/database/sampling/relax_scripts/MonomerRelax2019.txt ==================
protocols.relax.RelaxScriptManager: {0} repeat %%nrepeats%%
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 1.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.040
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.051
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.5
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.265
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.280
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.559
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.581
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 1
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} min 0.00001
protocols.relax.RelaxScriptManager: {0} accept_to_best
protocols.relax.RelaxScriptManager: {0} endrepeat

Running the folding algorithm!

In [25]:
scores = [0] * (jobs + 1)
scores[0] = scorefxn_low(test_pose)
In [26]:
if os.path.isdir(os.path.dirname(job_output)):
    shutil.rmtree(os.path.dirname(job_output), ignore_errors=True)
os.makedirs(os.path.dirname(job_output))
jd = prs.PyJobDistributor(job_output, nstruct=jobs, scorefxn=scorefxn_high)

Working on decoy: outputs/random/decoy_34.pdb
In [27]:
counter = 0 
while not jd.job_complete:
    # a. set necessary variables for the new trajectory
    # -reload the starting pose
    test_pose.assign(pose)
    to_centroid.apply(test_pose)
    # -change the pose's PDBInfo.name, for the PyMOL_Observer
    counter += 1
    test_pose.pdb_info().name(job_output + '_' + str(counter))
    # -reset the MonteCarlo object (sets lowest_score to that of test_pose)
    mc.reset(test_pose)

    #### if you create a custom protocol, you may have additional
    ####    variables to reset, such as kT

    #### if you create a custom protocol, this section will most likely
    ####    change, many protocols exist as single Movers or can be
    ####    chained together in a sequence (see above) so you need
    ####    only apply the final Mover
    # b. apply the refinement protocol
    folding.apply(test_pose)

    ####
    # c. export the lowest scoring decoy structure for this trajectory
    # -recover the lowest scoring decoy structure
    mc.recover_low(test_pose)
    # -store the final score for this trajectory
    # -convert the decoy to fullatom
    # the sidechain conformations will all be default,
    #    normally, the decoys would NOT be converted to fullatom before
    #    writing them to PDB (since a large number of trajectories would
    #    be considered and their fullatom score are unnecessary)
    # here the fullatom mode is reproduced to make the output easier to
    #    understand and manipulate, PyRosetta can load in PDB files of
    #    centroid structures, however you must convert to fullatom for
    #    nearly any other application
    to_full_atom.apply(test_pose)
    fast_relax_mover.apply(test_pose)
    scores[counter] = scorefxn_high(test_pose)
    # -output the fullatom decoy structure into a PDB file
    jd.output_decoy(test_pose)
    # -export the final structure to PyMOL
    test_pose.pdb_info().name(job_output + '_' + str(counter) + '_fa')

protocols.relax.FastRelax: {0} CMD: repeat  14549.7  0  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14549.7  0  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2402.9  0  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 619 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
basic.thread_manager.RosettaThreadManager: {?} Creating a thread pool of 8 threads.
basic.thread_manager.RosettaThread: {?} Launching thread 1.
basic.thread_manager.RosettaThread: {?} Launching thread 3.
basic.thread_manager.RosettaThreadPool: {?} Launched 7 new threads.
basic.thread_manager.RosettaThread: {4} Launching thread 4.
basic.thread_manager.RosettaThread: {6} Launching thread 6.
basic.thread_manager.RosettaThread: {5} Launching thread 5.
basic.thread_manager.RosettaThread: {2} Launching thread 2.
basic.random.init_random_generator: {1} 'RNG device' seed mode, using '/dev/urandom', seed=-1049107539 seed_offset=0 real_seed=-1049107538 thread_index=1
basic.random.init_random_generator: {1} RandomGenerator:init: Normal mode, seed=-1049107538 RG_type=mt19937
basic.random.init_random_generator: {4} 'RNG device' seed mode, using '/dev/urandom', seed=-1086195942 seed_offset=0 real_seed=-1086195938 thread_index=4
basic.random.init_random_generator: {4} RandomGenerator:init: Normal mode, seed=-1086195938 RG_type=mt19937
basic.random.init_random_generator: {3} 'RNG device' seed mode, using '/dev/urandom', seed=889554414 seed_offset=0 real_seed=889554417 thread_index=3
basic.random.init_random_generator: {3} RandomGenerator:init: Normal mode, seed=889554417 RG_type=mt19937
basic.random.init_random_generator: {6} 'RNG device' seed mode, using '/dev/urandom', seed=1923311294 seed_offset=0 real_seed=1923311300 thread_index=6
basic.random.init_random_generator: {6} RandomGenerator:init: Normal mode, seed=1923311300 RG_type=mt19937
basic.thread_manager.RosettaThread: {7} Launching thread 7.
basic.random.init_random_generator: {2} 'RNG device' seed mode, using '/dev/urandom', seed=-1691468736 seed_offset=0 real_seed=-1691468734 thread_index=2
basic.random.init_random_generator: {2} RandomGenerator:init: Normal mode, seed=-1691468734 RG_type=mt19937
basic.random.init_random_generator: {5} 'RNG device' seed mode, using '/dev/urandom', seed=-1446750116 seed_offset=0 real_seed=-1446750111 thread_index=5
basic.random.init_random_generator: {5} RandomGenerator:init: Normal mode, seed=-1446750111 RG_type=mt19937
basic.random.init_random_generator: {7} 'RNG device' seed mode, using '/dev/urandom', seed=-311569617 seed_offset=0 real_seed=-311569610 thread_index=7
basic.random.init_random_generator: {7} RandomGenerator:init: Normal mode, seed=-311569610 RG_type=mt19937
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  71.4705  0  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  72.8115  0  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  70.5143  0.356412  0.356412  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70.5143  0.356412  0.356412  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  101.969  0.356412  0.356412  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 592 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  88.2502  0.356412  0.356412  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  89.4639  0.356412  0.356412  0.154
protocols.relax.FastRelax: {0} CMD: min  124.5  4.22456  4.22456  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  124.5  4.22456  4.22456  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  263.857  4.22456  4.22456  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 707 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  254.761  4.22456  4.22456  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  265.569  4.22456  4.22456  0.31955
protocols.relax.FastRelax: {0} CMD: min  -7.03561  5.1084  5.1084  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -7.03561  5.1084  5.1084  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.02638  5.1084  5.1084  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.997478  5.1084  5.1084  0.55
protocols.relax.FastRelax: {0} CMD: min  -8.43189  6.11845  6.11845  0.55
protocols.relax.FastRelax: {0} MRP: 0  -8.43189  -8.43189  6.11845  6.11845
protocols.relax.FastRelax: {0} CMD: accept_to_best  -8.43189  6.11845  6.11845  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -8.43189  6.11845  6.11845  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.43189  6.11845  6.11845  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.8872  6.11845  6.11845  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 826 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.0547  6.11845  6.11845  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.7997  6.11845  6.11845  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.2684  6.01447  6.01447  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.2684  6.01447  6.01447  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.16398  6.01447  6.01447  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 755 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -7.73912  6.01447  6.01447  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.68038  6.01447  6.01447  0.154
protocols.relax.FastRelax: {0} CMD: min  -20.7122  6.70441  6.70441  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.7122  6.70441  6.70441  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.4826  6.70441  6.70441  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 775 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.6473  6.70441  6.70441  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.0097  6.70441  6.70441  0.31955
protocols.relax.FastRelax: {0} CMD: min  -12.8584  6.7122  6.7122  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.8584  6.7122  6.7122  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.34179  6.7122  6.7122  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 729 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.35539  6.7122  6.7122  0.55
protocols.relax.FastRelax: {0} CMD: min  -8.7356  8.59959  8.59959  0.55
protocols.relax.FastRelax: {0} MRP: 1  -8.7356  -8.7356  8.59959  8.59959
protocols.relax.FastRelax: {0} CMD: accept_to_best  -8.7356  8.59959  8.59959  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -8.7356  8.59959  8.59959  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.7356  8.59959  8.59959  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.4105  8.59959  8.59959  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 749 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.2334  8.59959  8.59959  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.977  8.59959  8.59959  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.097  8.93891  8.93891  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.097  8.93891  8.93891  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7287  8.93891  8.93891  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 776 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.7385  8.93891  8.93891  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7767  8.93891  8.93891  0.154
protocols.relax.FastRelax: {0} CMD: min  -23.0205  9.01385  9.01385  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.0205  9.01385  9.01385  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.833  9.01385  9.01385  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 723 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.0328  9.01385  9.01385  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4263  9.01385  9.01385  0.31955
protocols.relax.FastRelax: {0} CMD: min  -15.291  9.03257  9.03257  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.291  9.03257  9.03257  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -5.19122  9.03257  9.03257  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.19351  9.03257  9.03257  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.9314  8.64374  8.64374  0.55
protocols.relax.FastRelax: {0} MRP: 2  -10.9314  -10.9314  8.64374  8.64374
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.9314  8.64374  8.64374  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.9314  8.64374  8.64374  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.9314  8.64374  8.64374  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2511  8.64374  8.64374  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 819 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.9588  8.64374  8.64374  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.6702  8.64374  8.64374  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.5283  9.04663  9.04663  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.5283  9.04663  9.04663  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.0083  9.04663  9.04663  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 736 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.8449  9.04663  9.04663  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.4102  9.04663  9.04663  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.4704  9.02335  9.02335  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.4704  9.02335  9.02335  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.2518  9.02335  9.02335  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 729 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7777  9.02335  9.02335  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.1041  9.02335  9.02335  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.925  9.03634  9.03634  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.925  9.03634  9.03634  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -5.92223  9.03634  9.03634  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 685 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.70223  9.03634  9.03634  0.55
protocols.relax.FastRelax: {0} CMD: min  -13.0255  8.76989  8.76989  0.55
protocols.relax.FastRelax: {0} MRP: 3  -13.0255  -13.0255  8.76989  8.76989
protocols.relax.FastRelax: {0} CMD: accept_to_best  -13.0255  8.76989  8.76989  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -13.0255  8.76989  8.76989  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.0255  8.76989  8.76989  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6322  8.76989  8.76989  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 709 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.1398  8.76989  8.76989  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.9023  8.76989  8.76989  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.5136  8.7165  8.7165  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.5136  8.7165  8.7165  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.30917  8.7165  8.7165  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 682 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.46588  8.7165  8.7165  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.92142  8.7165  8.7165  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.7104  8.7551  8.7551  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7104  8.7551  8.7551  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.8452  8.7551  8.7551  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.9619  8.7551  8.7551  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.4428  8.7551  8.7551  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.077  8.7501  8.7501  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.077  8.7501  8.7501  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.3545  8.7501  8.7501  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.1341  8.7501  8.7501  0.55
protocols.relax.FastRelax: {0} CMD: min  -12.5886  8.80339  8.80339  0.55
protocols.relax.FastRelax: {0} MRP: 4  -12.5886  -13.0255  8.76989  8.76989
protocols.relax.FastRelax: {0} CMD: accept_to_best  -12.5886  8.80339  8.80339  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -12.5886  8.80339  8.80339  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_20.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14801.9  7.21381  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14801.9  7.21381  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1908.87  7.21381  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  160.631  7.21381  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  183.483  7.21381  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -15.2483  11.2015  7.88393  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.2483  11.2015  7.88393  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  23.7599  11.2015  7.88393  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 691 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  13.8215  11.2015  7.88393  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  15.8039  11.2015  7.88393  0.154
protocols.relax.FastRelax: {0} CMD: min  -14.6313  11.6945  8.88572  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.6313  11.6945  8.88572  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.65518  11.6945  8.88572  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 719 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.66115  11.6945  8.88572  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.87446  11.6945  8.88572  0.31955
protocols.relax.FastRelax: {0} CMD: min  -12.8413  12.0659  9.65336  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.8413  12.0659  9.65336  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.34818  12.0659  9.65336  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.81916  12.0659  9.65336  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.3285  11.4804  9.67265  0.55
protocols.relax.FastRelax: {0} MRP: 0  -14.3285  -14.3285  11.4804  9.67265
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.3285  11.4804  9.67265  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.3285  11.4804  9.67265  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.3285  11.4804  9.67265  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.8693  11.4804  9.67265  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.7177  11.4804  9.67265  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1121  11.4804  9.67265  0.02805
protocols.relax.FastRelax: {0} CMD: min  -30.1396  11.4782  9.67081  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.1396  11.4782  9.67081  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.363  11.4782  9.67081  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.5089  11.4782  9.67081  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2484  11.4782  9.67081  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.2691  11.4758  9.66832  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.2691  11.4758  9.66832  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.4162  11.4758  9.66832  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.5444  11.4758  9.66832  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1751  11.4758  9.66832  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.1838  11.4746  9.66704  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.1838  11.4746  9.66704  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.1449  11.4746  9.66704  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.4036  11.4746  9.66704  0.55
protocols.relax.FastRelax: {0} CMD: min  -15.5155  11.4107  9.59142  0.55
protocols.relax.FastRelax: {0} MRP: 1  -15.5155  -15.5155  11.4107  9.59142
protocols.relax.FastRelax: {0} CMD: accept_to_best  -15.5155  11.4107  9.59142  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -15.5155  11.4107  9.59142  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.5155  11.4107  9.59142  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.7169  11.4107  9.59142  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.0593  11.4107  9.59142  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4489  11.4107  9.59142  0.02805
protocols.relax.FastRelax: {0} CMD: min  -30.4721  11.4094  9.59036  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.4721  11.4094  9.59036  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.6123  11.4094  9.59036  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.8899  11.4094  9.59036  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.6293  11.4094  9.59036  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.6421  11.4074  9.5882  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.6421  11.4074  9.5882  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.7899  11.4074  9.5882  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.8781  11.4074  9.5882  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.509  11.4074  9.5882  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.5151  11.4061  9.58663  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.5151  11.4061  9.58663  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4854  11.4061  9.58663  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.783  11.4061  9.58663  0.55
protocols.relax.FastRelax: {0} CMD: min  -15.5176  11.3957  9.57856  0.55
protocols.relax.FastRelax: {0} MRP: 2  -15.5176  -15.5176  11.3957  9.57856
protocols.relax.FastRelax: {0} CMD: accept_to_best  -15.5176  11.3957  9.57856  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -15.5176  11.3957  9.57856  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.5176  11.3957  9.57856  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.7337  11.3957  9.57856  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.0458  11.3957  9.57856  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4325  11.3957  9.57856  0.02805
protocols.relax.FastRelax: {0} CMD: min  -30.4557  11.3944  9.57757  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.4557  11.3944  9.57757  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.5397  11.3944  9.57757  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.8856  11.3944  9.57757  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.6243  11.3944  9.57757  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.637  11.3924  9.57542  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.637  11.3924  9.57542  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.7722  11.3924  9.57542  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.8604  11.3924  9.57542  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.4903  11.3924  9.57542  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.4968  11.3911  9.57385  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.4968  11.3911  9.57385  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4482  11.3911  9.57385  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.7599  11.3911  9.57385  0.55
protocols.relax.FastRelax: {0} CMD: min  -15.5202  11.3893  9.5736  0.55
protocols.relax.FastRelax: {0} MRP: 3  -15.5202  -15.5202  11.3893  9.5736
protocols.relax.FastRelax: {0} CMD: accept_to_best  -15.5202  11.3893  9.5736  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -15.5202  11.3893  9.5736  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.5202  11.3893  9.5736  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.7358  11.3893  9.5736  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.0535  11.3893  9.5736  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4401  11.3893  9.5736  0.02805
protocols.relax.FastRelax: {0} CMD: min  -30.4634  11.388  9.57257  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.4634  11.388  9.57257  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.5481  11.388  9.57257  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.8881  11.388  9.57257  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.6269  11.388  9.57257  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.6397  11.3859  9.57039  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.6397  11.3859  9.57039  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.7771  11.3859  9.57039  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.8666  11.3859  9.57039  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.4967  11.3859  9.57039  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.5031  11.3846  9.56878  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.5031  11.3846  9.56878  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4578  11.3846  9.56878  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.7697  11.3846  9.56878  0.55
protocols.relax.FastRelax: {0} CMD: min  -15.5207  11.3864  9.5704  0.55
protocols.relax.FastRelax: {0} MRP: 4  -15.5207  -15.5207  11.3864  9.5704
protocols.relax.FastRelax: {0} CMD: accept_to_best  -15.5207  11.3864  9.5704  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -15.5207  11.3864  9.5704  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_48.pdb
protocols.relax.FastRelax: {0} CMD: repeat  12132.1  8.1634  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  12132.1  8.1634  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2138.62  8.1634  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  71.9363  8.1634  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  72.8534  8.1634  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  72.8116  8.16401  0.00589386  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72.8116  8.16401  0.00589386  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  90.607  8.16401  0.00589386  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  88.1832  8.16401  0.00589386  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  89.2682  8.16401  0.00589386  0.154
protocols.relax.FastRelax: {0} CMD: min  60.9384  9.56911  3.36463  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  60.9384  9.56911  3.36463  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  83.011  9.56911  3.36463  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  62.6523  9.56911  3.36463  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  63.5288  9.56911  3.36463  0.31955
protocols.relax.FastRelax: {0} CMD: min  52.5118  9.58158  3.2812  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  52.5118  9.58158  3.2812  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  61.2606  9.58158  3.2812  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  61.1467  9.58158  3.2812  0.55
core.optimization.LineMinimizer: {0} [ ERROR ] Inaccurate G! step= 3.8147e-06 Deriv= -0.110979 Finite Diff= 0.0162948
protocols.relax.FastRelax: {0} CMD: min  2613.93  9.86164  5.61817  0.55
protocols.relax.FastRelax: {0} MRP: 0  2613.93  2613.93  9.86164  5.61817
protocols.relax.FastRelax: {0} CMD: accept_to_best  2613.93  9.86164  5.61817  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  2613.93  9.86164  5.61817  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  2613.93  9.86164  5.61817  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  101.316  9.86164  5.61817  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  42.8898  9.86164  5.61817  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  56.5951  9.86164  5.61817  0.02805
protocols.relax.FastRelax: {0} CMD: min  746.794  11.4258  8.37269  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  746.794  11.4258  8.37269  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  3962.95  11.4258  8.37269  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 584 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  2678.49  11.4258  8.37269  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2831.15  11.4258  8.37269  0.154
protocols.relax.FastRelax: {0} CMD: min  124.137  9.25089  3.77646  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  124.137  9.25089  3.77646  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  263.302  9.25089  3.77646  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 616 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  130.503  9.25089  3.77646  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  136.338  9.25089  3.77646  0.31955
protocols.relax.FastRelax: {0} CMD: min  -4.05858  9.20205  3.89241  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.05858  9.20205  3.89241  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.51567  9.20205  3.89241  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  3.20653  9.20205  3.89241  0.55
protocols.relax.FastRelax: {0} CMD: min  -4.81317  9.24556  5.11487  0.55
protocols.relax.FastRelax: {0} MRP: 1  -4.81317  -4.81317  9.24556  5.11487
protocols.relax.FastRelax: {0} CMD: accept_to_best  -4.81317  9.24556  5.11487  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -4.81317  9.24556  5.11487  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.81317  9.24556  5.11487  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.1407  9.24556  5.11487  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.5173  9.24556  5.11487  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.3658  9.24556  5.11487  0.02805
protocols.relax.FastRelax: {0} CMD: min  -19.8147  9.24481  5.11457  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.8147  9.24481  5.11457  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7988  9.24481  5.11457  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7989  9.24481  5.11457  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.5875  9.24481  5.11457  0.154
protocols.relax.FastRelax: {0} CMD: min  -16.6147  9.24403  5.11311  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6147  9.24403  5.11311  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.6765  9.24403  5.11311  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.6766  9.24403  5.11311  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.3661  9.24403  5.11311  0.31955
protocols.relax.FastRelax: {0} CMD: min  -12.3912  9.24281  5.11241  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.3912  9.24281  5.11241  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.51511  9.24281  5.11241  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -6.51512  9.24281  5.11241  0.55
core.optimization.LineMinimizer: {0} [ ERROR ] Inaccurate G! step= 3.8147e-06 Deriv= -0.0075623 Finite Diff= 0.00545268
protocols.relax.FastRelax: {0} CMD: min  -12.6345  9.80946  7.74094  0.55
protocols.relax.FastRelax: {0} MRP: 2  -12.6345  -12.6345  9.80946  7.74094
protocols.relax.FastRelax: {0} CMD: accept_to_best  -12.6345  9.80946  7.74094  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -12.6345  9.80946  7.74094  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.6345  9.80946  7.74094  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5952  9.80946  7.74094  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9004  9.80946  7.74094  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7437  9.80946  7.74094  0.02805
protocols.relax.FastRelax: {0} CMD: min  -36.0246  9.9637  8.72129  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.0246  9.9637  8.72129  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.6573  9.9637  8.72129  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 665 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.1269  9.9637  8.72129  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.1028  9.9637  8.72129  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.4231  9.98311  8.62986  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.4231  9.98311  8.62986  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.7449  9.98311  8.62986  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.7449  9.98311  8.62986  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.1395  9.98311  8.62986  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.5363  9.95864  8.61156  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.5363  9.95864  8.61156  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.15563  9.95864  8.61156  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.25762  9.95864  8.61156  0.55
core.optimization.LineMinimizer: {0} [ ERROR ] Inaccurate G! step= 3.8147e-06 Deriv= -0.0154134 Finite Diff= 0.0156168
protocols.relax.FastRelax: {0} CMD: min  -16.0622  10.9577  11.5277  0.55
protocols.relax.FastRelax: {0} MRP: 3  -16.0622  -16.0622  10.9577  11.5277
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.0622  10.9577  11.5277  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.0622  10.9577  11.5277  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.0622  10.9577  11.5277  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.8116  10.9577  11.5277  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.1933  10.9577  11.5277  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.0097  10.9577  11.5277  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.6761  10.6304  11.0006  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.6761  10.6304  11.0006  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.2894  10.6304  11.0006  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.6069  10.6304  11.0006  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.4342  10.6304  11.0006  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.5792  10.6895  11.1123  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.5792  10.6895  11.1123  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0841  10.6895  11.1123  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 653 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.0841  10.6895  11.1123  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.4142  10.6895  11.1123  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.105  10.685  11.1572  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.105  10.685  11.1572  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.915  10.685  11.1572  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.9898  10.685  11.1572  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.838  10.6053  10.9948  0.55
protocols.relax.FastRelax: {0} MRP: 4  -19.838  -19.838  10.6053  10.9948
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.838  10.6053  10.9948  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.838  10.6053  10.9948  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_4.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15133.4  7.74311  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15133.4  7.74311  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2208.64  7.74311  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 615 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  100.47  7.74311  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  118.857  7.74311  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  100.292  8.42868  6.05007  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  100.292  8.42868  6.05007  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  723.766  8.42868  6.05007  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.1693  8.42868  6.05007  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.6006  8.42868  6.05007  0.154
protocols.relax.FastRelax: {0} CMD: min  -34.5057  8.58481  6.35058  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.5057  8.58481  6.35058  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.7914  8.58481  6.35058  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.97  8.58481  6.35058  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.2228  8.58481  6.35058  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.6478  8.57378  6.35131  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.6478  8.57378  6.35131  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.0898  8.57378  6.35131  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.1002  8.57378  6.35131  0.55
protocols.relax.FastRelax: {0} CMD: min  -23.5485  8.8282  7.09862  0.55
protocols.relax.FastRelax: {0} MRP: 0  -23.5485  -23.5485  8.8282  7.09862
protocols.relax.FastRelax: {0} CMD: accept_to_best  -23.5485  8.8282  7.09862  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -23.5485  8.8282  7.09862  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.5485  8.8282  7.09862  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.7159  8.8282  7.09862  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.655  8.8282  7.09862  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.4612  8.8282  7.09862  0.02805
protocols.relax.FastRelax: {0} CMD: min  -49.4387  8.96569  6.95549  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.4387  8.96569  6.95549  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.8557  8.96569  6.95549  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 822 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.9888  8.96569  6.95549  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.6608  8.96569  6.95549  0.154
protocols.relax.FastRelax: {0} CMD: min  -37.5057  8.90787  7.06814  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.5057  8.90787  7.06814  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.5338  8.90787  7.06814  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.9417  8.90787  7.06814  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2431  8.90787  7.06814  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.0036  8.89434  7.0422  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.0036  8.89434  7.0422  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.0214  8.89434  7.0422  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.0242  8.89434  7.0422  0.55
protocols.relax.FastRelax: {0} CMD: min  -27.8976  9.34858  7.34431  0.55
protocols.relax.FastRelax: {0} MRP: 1  -27.8976  -27.8976  9.34858  7.34431
protocols.relax.FastRelax: {0} CMD: accept_to_best  -27.8976  9.34858  7.34431  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -27.8976  9.34858  7.34431  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.8976  9.34858  7.34431  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.6428  9.34858  7.34431  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.2185  9.34858  7.34431  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.0187  9.34858  7.34431  0.02805
protocols.relax.FastRelax: {0} CMD: min  -48.6046  9.35479  7.26816  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.6046  9.35479  7.26816  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.4662  9.35479  7.26816  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 717 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.453  9.35479  7.26816  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5339  9.35479  7.26816  0.154
protocols.relax.FastRelax: {0} CMD: min  -42.625  9.34748  7.23961  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.625  9.34748  7.23961  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.547  9.34748  7.23961  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5546  9.34748  7.23961  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9178  9.34748  7.23961  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.9055  9.34659  7.22921  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.9055  9.34659  7.22921  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3962  9.34659  7.22921  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.3987  9.34659  7.22921  0.55
protocols.relax.FastRelax: {0} CMD: min  -33.4894  9.56987  7.47853  0.55
protocols.relax.FastRelax: {0} MRP: 2  -33.4894  -33.4894  9.56987  7.47853
protocols.relax.FastRelax: {0} CMD: accept_to_best  -33.4894  9.56987  7.47853  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -33.4894  9.56987  7.47853  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4894  9.56987  7.47853  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.8192  9.56987  7.47853  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 728 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.248  9.56987  7.47853  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.0385  9.56987  7.47853  0.02805
protocols.relax.FastRelax: {0} CMD: min  -52.7655  9.56459  7.44259  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.7655  9.56459  7.44259  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.2652  9.56459  7.44259  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.6892  9.56459  7.44259  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.8552  9.56459  7.44259  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.101  9.59316  7.5309  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.101  9.59316  7.5309  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.625  9.59316  7.5309  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.9276  9.59316  7.5309  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.3382  9.59316  7.5309  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.1673  9.62311  7.51892  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.1673  9.62311  7.51892  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.6601  9.62311  7.51892  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.6634  9.62311  7.51892  0.55
protocols.relax.FastRelax: {0} CMD: min  -33.4896  9.57271  7.48572  0.55
protocols.relax.FastRelax: {0} MRP: 3  -33.4896  -33.4896  9.57271  7.48572
protocols.relax.FastRelax: {0} CMD: accept_to_best  -33.4896  9.57271  7.48572  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -33.4896  9.57271  7.48572  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4896  9.57271  7.48572  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.8586  9.57271  7.48572  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 728 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.2878  9.57271  7.48572  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.0769  9.57271  7.48572  0.02805
protocols.relax.FastRelax: {0} CMD: min  -52.7821  9.56723  7.44996  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.7821  9.56723  7.44996  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.1768  9.56723  7.44996  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.609  9.56723  7.44996  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.7685  9.56723  7.44996  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.1827  9.59635  7.53458  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.1827  9.59635  7.53458  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.6647  9.59635  7.53458  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.9251  9.59635  7.53458  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.3317  9.59635  7.53458  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.1532  9.62964  7.52111  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.1532  9.62964  7.52111  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7108  9.62964  7.52111  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.7109  9.62964  7.52111  0.55
protocols.relax.FastRelax: {0} CMD: min  -33.4891  9.5735  7.48753  0.55
protocols.relax.FastRelax: {0} MRP: 4  -33.4891  -33.4896  9.57271  7.48572
protocols.relax.FastRelax: {0} CMD: accept_to_best  -33.4891  9.5735  7.48753  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -33.4891  9.5735  7.48753  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_24.pdb
protocols.relax.FastRelax: {0} CMD: repeat  12022.6  5.96034  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  12022.6  5.96034  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1769.25  5.96034  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 804 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  60.3224  5.96034  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  66.1538  5.96034  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -36.7941  7.01929  2.70254  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.7941  7.01929  2.70254  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.6729  7.01929  2.70254  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 933 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.4768  7.01929  2.70254  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.8549  7.01929  2.70254  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.1464  7.16511  2.72841  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.1464  7.16511  2.72841  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.60789  7.16511  2.72841  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 878 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.7139  7.16511  2.72841  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.53166  7.16511  2.72841  0.31955
protocols.relax.FastRelax: {0} CMD: min  -27.7186  7.51784  3.21492  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.7186  7.51784  3.21492  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.9766  7.51784  3.21492  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1027 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.2248  7.51784  3.21492  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.6359  7.79456  3.92096  0.55
protocols.relax.FastRelax: {0} MRP: 0  -28.6359  -28.6359  7.79456  3.92096
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.6359  7.79456  3.92096  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.6359  7.79456  3.92096  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.6359  7.79456  3.92096  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -45.9102  7.79456  3.92096  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1202 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.8247  7.79456  3.92096  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.5067  7.79456  3.92096  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.5477  7.75868  3.89806  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.5477  7.75868  3.89806  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1932  7.75868  3.89806  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1160 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.765  7.75868  3.89806  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.7694  7.75868  3.89806  0.154
protocols.relax.FastRelax: {0} CMD: min  -43.6232  7.73599  3.89222  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.6232  7.73599  3.89222  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.31  7.73599  3.89222  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1156 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.3107  7.73599  3.89222  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.5764  7.73599  3.89222  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.4275  7.7613  3.90617  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.4275  7.7613  3.90617  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.3383  7.7613  3.90617  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1063 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.56  7.7613  3.90617  0.55
protocols.relax.FastRelax: {0} CMD: min  -34.8859  7.75647  4.16155  0.55
protocols.relax.FastRelax: {0} MRP: 1  -34.8859  -34.8859  7.75647  4.16155
protocols.relax.FastRelax: {0} CMD: accept_to_best  -34.8859  7.75647  4.16155  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -34.8859  7.75647  4.16155  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.8859  7.75647  4.16155  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.8816  7.75647  4.16155  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1080 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -54.4738  7.75647  4.16155  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -54.0928  7.75647  4.16155  0.02805
protocols.relax.FastRelax: {0} CMD: min  -59.5942  7.84079  4.24232  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -59.5942  7.84079  4.24232  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -45.8241  7.84079  4.24232  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1037 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.4632  7.84079  4.24232  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.689  7.84079  4.24232  0.154
protocols.relax.FastRelax: {0} CMD: min  -50.0211  7.82134  4.21807  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.0211  7.82134  4.21807  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.3584  7.82134  4.21807  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1081 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.7513  7.82134  4.21807  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.9365  7.82134  4.21807  0.31955
protocols.relax.FastRelax: {0} CMD: min  -39.7358  7.8085  4.20504  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.7358  7.8085  4.20504  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3417  7.8085  4.20504  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1054 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.331  7.8085  4.20504  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.2138  7.78594  4.18866  0.55
protocols.relax.FastRelax: {0} MRP: 2  -35.2138  -35.2138  7.78594  4.18866
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.2138  7.78594  4.18866  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.2138  7.78594  4.18866  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.2138  7.78594  4.18866  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -53.0866  7.78594  4.18866  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1079 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -54.6152  7.78594  4.18866  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -54.2356  7.78594  4.18866  0.02805
protocols.relax.FastRelax: {0} CMD: min  -57.7185  7.87738  4.26911  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -57.7185  7.87738  4.26911  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.2925  7.87738  4.26911  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1024 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.3226  7.87738  4.26911  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.0562  7.87738  4.26911  0.154
protocols.relax.FastRelax: {0} CMD: min  -50.1693  7.83575  4.23755  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.1693  7.83575  4.23755  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.758  7.83575  4.23755  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1073 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.9054  7.83575  4.23755  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1001  7.83575  4.23755  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.2011  7.82486  4.22316  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.2011  7.82486  4.22316  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.5946  7.82486  4.22316  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1034 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.5956  7.82486  4.22316  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.2342  7.78174  4.18586  0.55
protocols.relax.FastRelax: {0} MRP: 3  -35.2342  -35.2342  7.78174  4.18586
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.2342  7.78174  4.18586  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.2342  7.78174  4.18586  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.2342  7.78174  4.18586  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -53.1332  7.78174  4.18586  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1085 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -54.651  7.78174  4.18586  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -54.2727  7.78174  4.18586  0.02805
protocols.relax.FastRelax: {0} CMD: min  -57.5968  7.88318  4.27081  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -57.5968  7.88318  4.27081  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.6608  7.88318  4.27081  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1024 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.8713  7.88318  4.27081  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.5754  7.88318  4.27081  0.154
protocols.relax.FastRelax: {0} CMD: min  -49.8918  7.80159  4.23102  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.8918  7.80159  4.23102  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.9263  7.80159  4.23102  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1079 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.0285  7.80159  4.23102  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.2432  7.80159  4.23102  0.31955
protocols.relax.FastRelax: {0} CMD: min  -41.1667  7.80941  4.21308  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.1667  7.80941  4.21308  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2979  7.80941  4.21308  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1012 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.2987  7.80941  4.21308  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.2546  7.78882  4.19152  0.55
protocols.relax.FastRelax: {0} MRP: 4  -35.2546  -35.2546  7.78882  4.19152
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.2546  7.78882  4.19152  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.2546  7.78882  4.19152  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_47.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15597.2  9.36402  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15597.2  9.36402  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1942.27  9.36402  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 756 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  96.6008  9.36402  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  105.813  9.36402  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -17.6396  9.6364  2.29668  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6396  9.6364  2.29668  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  11.3543  9.6364  2.29668  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  9.49926  9.6364  2.29668  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  11.4446  9.6364  2.29668  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.7006  9.54383  2.15441  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.7006  9.54383  2.15441  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.93745  9.54383  2.15441  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 681 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.05866  9.54383  2.15441  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.21488  9.54383  2.15441  0.31955
protocols.relax.FastRelax: {0} CMD: min  -6.97569  9.53309  2.15457  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -6.97569  9.53309  2.15457  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.01123  9.53309  2.15457  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  4.00762  9.53309  2.15457  0.55
protocols.relax.FastRelax: {0} CMD: min  -2.48786  9.5393  2.72965  0.55
protocols.relax.FastRelax: {0} MRP: 0  -2.48786  -2.48786  9.5393  2.72965
protocols.relax.FastRelax: {0} CMD: accept_to_best  -2.48786  9.5393  2.72965  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -2.48786  9.5393  2.72965  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -2.48786  9.5393  2.72965  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5386  9.5393  2.72965  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 717 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.7574  9.5393  2.72965  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5441  9.5393  2.72965  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.2278  9.52478  2.88109  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.2278  9.52478  2.88109  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  5.01208  9.52478  2.88109  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 798 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  0.870271  9.52478  2.88109  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.8012  9.52478  2.88109  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.0095  9.47728  3.08533  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.0095  9.47728  3.08533  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.5394  9.47728  3.08533  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 815 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.5431  9.47728  3.08533  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.7201  9.47728  3.08533  0.31955
protocols.relax.FastRelax: {0} CMD: min  -15.0361  9.46572  3.07126  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.0361  9.46572  3.07126  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.88157  9.46572  3.07126  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 808 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.09709  9.46572  3.07126  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.029  9.57986  3.17691  0.55
protocols.relax.FastRelax: {0} MRP: 1  -11.029  -11.029  9.57986  3.17691
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.029  9.57986  3.17691  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.029  9.57986  3.17691  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.029  9.57986  3.17691  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.4104  9.57986  3.17691  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 843 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.4995  9.57986  3.17691  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2395  9.57986  3.17691  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.5541  9.61494  3.28072  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.5541  9.61494  3.28072  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.2788  9.61494  3.28072  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 827 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.1193  9.61494  3.28072  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7603  9.61494  3.28072  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.3217  9.55748  3.2007  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.3217  9.55748  3.2007  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.7094  9.55748  3.2007  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 820 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.7129  9.55748  3.2007  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.9548  9.55748  3.2007  0.31955
protocols.relax.FastRelax: {0} CMD: min  -18.6674  9.54524  3.15167  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.6674  9.54524  3.15167  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.31643  9.54524  3.15167  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 808 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.32742  9.54524  3.15167  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.8163  9.59968  3.19211  0.55
protocols.relax.FastRelax: {0} MRP: 2  -11.8163  -11.8163  9.59968  3.19211
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.8163  9.59968  3.19211  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.8163  9.59968  3.19211  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.8163  9.59968  3.19211  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.0198  9.59968  3.19211  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 841 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.723  9.59968  3.19211  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4668  9.59968  3.19211  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.1128  9.60784  3.20511  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.1128  9.60784  3.20511  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.6883  9.60784  3.20511  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 821 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.885  9.60784  3.20511  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.9639  9.60784  3.20511  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.0237  9.59944  3.23239  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.0237  9.59944  3.23239  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.6252  9.59944  3.23239  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 821 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.6252  9.59944  3.23239  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.963  9.59944  3.23239  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.1377  9.58157  3.2008  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.1377  9.58157  3.2008  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.30991  9.58157  3.2008  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 808 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.311  9.58157  3.2008  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.8176  9.59879  3.18885  0.55
protocols.relax.FastRelax: {0} MRP: 3  -11.8176  -11.8176  9.59879  3.18885
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.8176  9.59879  3.18885  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.8176  9.59879  3.18885  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.8176  9.59879  3.18885  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.007  9.59879  3.18885  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 840 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6969  9.59879  3.18885  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4417  9.59879  3.18885  0.02805
protocols.relax.FastRelax: {0} CMD: min  -38.8311  9.63205  3.26785  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.8311  9.63205  3.26785  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.427  9.63205  3.26785  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 826 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.8383  9.63205  3.26785  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.5672  9.63205  3.26785  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.7549  9.59495  3.21357  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.7549  9.59495  3.21357  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.1037  9.59495  3.21357  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 811 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.1648  9.59495  3.21357  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.4132  9.59495  3.21357  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.845  9.59175  3.20628  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.845  9.59175  3.20628  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.44642  9.59175  3.20628  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 806 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.44703  9.59175  3.20628  0.55
protocols.relax.FastRelax: {0} CMD: min  -12.5396  9.59666  3.2009  0.55
protocols.relax.FastRelax: {0} MRP: 4  -12.5396  -12.5396  9.59666  3.2009
protocols.relax.FastRelax: {0} CMD: accept_to_best  -12.5396  9.59666  3.2009  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -12.5396  9.59666  3.2009  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_30.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16010.1  8.48056  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16010.1  8.48056  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2238.9  8.48056  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  70.6847  8.48056  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  72.7797  8.48056  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  72.7004  8.48314  0.00386485  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72.7004  8.48314  0.00386485  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  113.198  8.48314  0.00386485  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  108.887  8.48314  0.00386485  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  111.295  8.48314  0.00386485  0.154
protocols.relax.FastRelax: {0} CMD: min  -3.31302  11.3208  8.21862  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -3.31302  11.3208  8.21862  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  0.667492  11.3208  8.21862  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 701 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.83217  11.3208  8.21862  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.46302  11.3208  8.21862  0.31955
protocols.relax.FastRelax: {0} CMD: min  -4.48554  11.3191  8.21938  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.48554  11.3191  8.21938  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.53147  11.3191  8.21938  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 695 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  2.08287  11.3191  8.21938  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.7696  10.6398  11.4761  0.55
protocols.relax.FastRelax: {0} MRP: 0  -14.7696  -14.7696  10.6398  11.4761
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.7696  10.6398  11.4761  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.7696  10.6398  11.4761  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.7696  10.6398  11.4761  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0994  10.6398  11.4761  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 719 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.222  10.6398  11.4761  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.0335  10.6398  11.4761  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.0407  10.6393  11.4765  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.0407  10.6393  11.4765  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.3726  10.6393  11.4765  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.0253  10.6393  11.4765  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.8407  10.6393  11.4765  0.154
protocols.relax.FastRelax: {0} CMD: min  -22.845  10.6387  11.4769  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.845  10.6387  11.4769  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4111  10.6387  11.4769  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 690 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.4513  10.6387  11.4769  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.1849  10.6387  11.4769  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.193  10.6378  11.4772  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.193  10.6378  11.4772  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.1246  10.6378  11.4772  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 688 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.358  10.6378  11.4772  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.4495  10.5417  11.4698  0.55
protocols.relax.FastRelax: {0} MRP: 1  -16.4495  -16.4495  10.5417  11.4698
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.4495  10.5417  11.4698  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.4495  10.5417  11.4698  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.4495  10.5417  11.4698  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2514  10.5417  11.4698  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 718 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.165  10.5417  11.4698  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9851  10.5417  11.4698  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.9934  10.541  11.4702  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9934  10.541  11.4702  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.4921  10.541  11.4702  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.1467  10.541  11.4702  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.9739  10.541  11.4702  0.154
protocols.relax.FastRelax: {0} CMD: min  -23.9779  10.5404  11.4706  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.9779  10.5404  11.4706  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7631  10.5404  11.4706  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.7631  10.5404  11.4706  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5096  10.5404  11.4706  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.5135  10.5398  11.4708  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.5135  10.5398  11.4708  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.6876  10.5398  11.4708  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.9508  10.5398  11.4708  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.452  10.5456  11.4501  0.55
protocols.relax.FastRelax: {0} MRP: 2  -16.452  -16.452  10.5456  11.4501
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.452  10.5456  11.4501  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.452  10.5456  11.4501  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.452  10.5456  11.4501  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2346  10.5456  11.4501  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 718 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1665  10.5456  11.4501  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9865  10.5456  11.4501  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.9948  10.545  11.4506  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9948  10.545  11.4506  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.4915  10.545  11.4506  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.1453  10.545  11.4506  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.9724  10.545  11.4506  0.154
protocols.relax.FastRelax: {0} CMD: min  -23.9763  10.5443  11.4509  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.9763  10.5443  11.4509  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7573  10.5443  11.4509  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.7573  10.5443  11.4509  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5035  10.5443  11.4509  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.5076  10.5437  11.4511  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.5076  10.5437  11.4511  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.6758  10.5437  11.4511  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 686 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.9493  10.5437  11.4511  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.4528  10.5368  11.4353  0.55
protocols.relax.FastRelax: {0} MRP: 3  -16.4528  -16.4528  10.5368  11.4353
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.4528  10.5368  11.4353  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.4528  10.5368  11.4353  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.4528  10.5368  11.4353  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2354  10.5368  11.4353  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 718 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1674  10.5368  11.4353  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9877  10.5368  11.4353  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.9959  10.5362  11.4358  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9959  10.5362  11.4358  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.4968  10.5362  11.4358  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.1506  10.5362  11.4358  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.9779  10.5362  11.4358  0.154
protocols.relax.FastRelax: {0} CMD: min  -23.9818  10.5355  11.4362  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.9818  10.5355  11.4362  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7682  10.5355  11.4362  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.7682  10.5355  11.4362  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5148  10.5355  11.4362  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.5187  10.535  11.4364  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.5187  10.535  11.4364  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.6947  10.535  11.4364  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.9472  10.535  11.4364  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.4587  10.5183  11.4334  0.55
protocols.relax.FastRelax: {0} MRP: 4  -16.4587  -16.4587  10.5183  11.4334
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.4587  10.5183  11.4334  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.4587  10.5183  11.4334  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_25.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16632.1  7.40067  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16632.1  7.40067  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1913.52  7.40067  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 612 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  51.8134  7.40067  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  59.5097  7.40067  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.0857  7.3676  4.23177  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.0857  7.3676  4.23177  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.8966  7.3676  4.23177  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.9477  7.3676  4.23177  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.5967  7.3676  4.23177  0.154
protocols.relax.FastRelax: {0} CMD: min  -38.3092  7.65233  5.17837  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.3092  7.65233  5.17837  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2896  7.65233  5.17837  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.1291  7.65233  5.17837  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4827  7.65233  5.17837  0.31955
protocols.relax.FastRelax: {0} CMD: min  -36.7743  7.77021  5.24881  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.7743  7.77021  5.24881  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.9528  7.77021  5.24881  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.134  7.77021  5.24881  0.55
protocols.relax.FastRelax: {0} CMD: min  -33.5701  8.30674  7.13038  0.55
protocols.relax.FastRelax: {0} MRP: 0  -33.5701  -33.5701  8.30674  7.13038
protocols.relax.FastRelax: {0} CMD: accept_to_best  -33.5701  8.30674  7.13038  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -33.5701  8.30674  7.13038  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.5701  8.30674  7.13038  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.8306  8.30674  7.13038  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 653 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -53.302  8.30674  7.13038  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.3895  8.30674  7.13038  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.9702  8.25457  6.93502  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.9702  8.25457  6.93502  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.0199  8.25457  6.93502  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.5776  8.25457  6.93502  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.2739  8.25457  6.93502  0.154
protocols.relax.FastRelax: {0} CMD: min  -49.9802  8.15658  7.05483  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.9802  8.15658  7.05483  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.6168  8.15658  7.05483  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.6565  8.15658  7.05483  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.0005  8.15658  7.05483  0.31955
protocols.relax.FastRelax: {0} CMD: min  -41.606  8.16535  7.08273  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.606  8.16535  7.08273  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.0996  8.16535  7.08273  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6181  8.16535  7.08273  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.768  8.59261  7.6013  0.55
protocols.relax.FastRelax: {0} MRP: 1  -35.768  -35.768  8.59261  7.6013
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.768  8.59261  7.6013  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.768  8.59261  7.6013  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.768  8.59261  7.6013  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.0829  8.59261  7.6013  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -54.1416  8.59261  7.6013  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -53.2323  8.59261  7.6013  0.02805
protocols.relax.FastRelax: {0} CMD: min  -55.6582  8.53627  7.40201  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -55.6582  8.53627  7.40201  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.1675  8.53627  7.40201  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.7359  8.53627  7.40201  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.3936  8.53627  7.40201  0.154
protocols.relax.FastRelax: {0} CMD: min  -50.1288  8.40615  7.54565  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.1288  8.40615  7.54565  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.5878  8.40615  7.54565  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.6412  8.40615  7.54565  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.9728  8.40615  7.54565  0.31955
protocols.relax.FastRelax: {0} CMD: min  -43.0885  8.52719  7.52236  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.0885  8.52719  7.52236  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.834  8.52719  7.52236  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 615 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.0713  8.52719  7.52236  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.7673  8.61602  7.63263  0.55
protocols.relax.FastRelax: {0} MRP: 2  -35.7673  -35.768  8.59261  7.6013
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.7673  8.61602  7.63263  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.7673  8.61602  7.63263  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.7673  8.61602  7.63263  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.105  8.61602  7.63263  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -54.1595  8.61602  7.63263  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -53.2491  8.61602  7.63263  0.02805
protocols.relax.FastRelax: {0} CMD: min  -55.732  8.55699  7.43352  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -55.732  8.55699  7.43352  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.7339  8.55699  7.43352  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.3803  8.55699  7.43352  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.0758  8.55699  7.43352  0.154
protocols.relax.FastRelax: {0} CMD: min  -50.0313  8.43753  7.60112  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.0313  8.43753  7.60112  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.0019  8.43753  7.60112  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.0344  8.43753  7.60112  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.4053  8.43753  7.60112  0.31955
protocols.relax.FastRelax: {0} CMD: min  -42.6833  8.47758  7.57023  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.6833  8.47758  7.57023  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.4245  8.47758  7.57023  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 619 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.0468  8.47758  7.57023  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.7785  8.59902  7.61281  0.55
protocols.relax.FastRelax: {0} MRP: 3  -35.7785  -35.7785  8.59902  7.61281
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.7785  8.59902  7.61281  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.7785  8.59902  7.61281  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.7785  8.59902  7.61281  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.095  8.59902  7.61281  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -54.0885  8.59902  7.61281  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -53.178  8.59902  7.61281  0.02805
protocols.relax.FastRelax: {0} CMD: min  -55.6572  8.54192  7.41357  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -55.6572  8.54192  7.41357  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4016  8.54192  7.41357  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.9808  8.54192  7.41357  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.6558  8.54192  7.41357  0.154
protocols.relax.FastRelax: {0} CMD: min  -50.421  8.43192  7.52488  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.421  8.43192  7.52488  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.602  8.43192  7.52488  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.6482  8.43192  7.52488  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.0359  8.43192  7.52488  0.31955
protocols.relax.FastRelax: {0} CMD: min  -42.2981  8.43497  7.53552  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.2981  8.43497  7.53552  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.1206  8.43497  7.53552  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 623 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.739  8.43497  7.53552  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.7656  8.61125  7.62711  0.55
protocols.relax.FastRelax: {0} MRP: 4  -35.7656  -35.7785  8.59902  7.61281
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.7656  8.61125  7.62711  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.7656  8.61125  7.62711  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_19.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15759.3  9.18135  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15759.3  9.18135  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2156.23  9.18135  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 753 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  68.175  9.18135  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  82.2555  9.18135  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.2437  9.24806  1.32816  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.2437  9.24806  1.32816  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.3497  9.24806  1.32816  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 718 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.3465  9.24806  1.32816  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.8515  9.24806  1.32816  0.154
protocols.relax.FastRelax: {0} CMD: min  -35.1563  9.31684  1.26477  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.1563  9.31684  1.26477  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.7981  9.31684  1.26477  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 767 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.0416  9.31684  1.26477  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4099  9.31684  1.26477  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.6009  9.30983  1.26658  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.6009  9.30983  1.26658  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.0822  9.30983  1.26658  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 761 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.0833  9.30983  1.26658  0.55
protocols.relax.FastRelax: {0} CMD: min  -27.7322  9.36016  1.20211  0.55
protocols.relax.FastRelax: {0} MRP: 0  -27.7322  -27.7322  9.36016  1.20211
protocols.relax.FastRelax: {0} CMD: accept_to_best  -27.7322  9.36016  1.20211  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -27.7322  9.36016  1.20211  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.7322  9.36016  1.20211  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.6027  9.36016  1.20211  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 739 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.4821  9.36016  1.20211  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.2943  9.36016  1.20211  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.894  9.38118  1.19949  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.894  9.38118  1.19949  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.8605  9.38118  1.19949  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 709 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.8607  9.38118  1.19949  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.578  9.38118  1.19949  0.154
protocols.relax.FastRelax: {0} CMD: min  -38.6986  9.36982  1.19849  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.6986  9.36982  1.19849  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.6557  9.36982  1.19849  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 701 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.6562  9.36982  1.19849  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.2586  9.36982  1.19849  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.2986  9.3622  1.20057  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.2986  9.3622  1.20057  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9442  9.3622  1.20057  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.6748  9.3622  1.20057  0.55
protocols.relax.FastRelax: {0} CMD: min  -27.9563  9.40057  1.2548  0.55
protocols.relax.FastRelax: {0} MRP: 1  -27.9563  -27.9563  9.40057  1.2548
protocols.relax.FastRelax: {0} CMD: accept_to_best  -27.9563  9.40057  1.2548  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -27.9563  9.40057  1.2548  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.9563  9.40057  1.2548  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.9095  9.40057  1.2548  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 729 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.8496  9.40057  1.2548  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.6588  9.40057  1.2548  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.2594  9.4213  1.25626  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2594  9.4213  1.25626  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.171  9.4213  1.25626  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 697 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.1712  9.4213  1.25626  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.8847  9.4213  1.25626  0.154
protocols.relax.FastRelax: {0} CMD: min  -38.9641  9.41223  1.2564  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.9641  9.41223  1.2564  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.852  9.41223  1.2564  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 691 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.8523  9.41223  1.2564  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4493  9.41223  1.2564  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.5016  9.40434  1.25626  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.5016  9.40434  1.25626  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.043  9.40434  1.25626  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 684 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.7722  9.40434  1.25626  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.0563  9.40527  1.27349  0.55
protocols.relax.FastRelax: {0} MRP: 2  -28.0563  -28.0563  9.40527  1.27349
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.0563  9.40527  1.27349  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.0563  9.40527  1.27349  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.0563  9.40527  1.27349  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.9648  9.40527  1.27349  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 762 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.8461  9.40527  1.27349  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.6567  9.40527  1.27349  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.2542  9.42634  1.27608  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2542  9.42634  1.27608  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1884  9.42634  1.27608  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 731 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.1886  9.42634  1.27608  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.9036  9.42634  1.27608  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.0245  9.41478  1.27036  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.0245  9.41478  1.27036  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9391  9.41478  1.27036  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 725 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.9396  9.41478  1.27036  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.5387  9.41478  1.27036  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.5807  9.4071  1.27216  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.5807  9.4071  1.27216  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.1678  9.4071  1.27216  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 718 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.8894  9.4071  1.27216  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.0573  9.40672  1.27909  0.55
protocols.relax.FastRelax: {0} MRP: 3  -28.0573  -28.0573  9.40672  1.27909
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.0573  9.40672  1.27909  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.0573  9.40672  1.27909  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.0573  9.40672  1.27909  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.9549  9.40672  1.27909  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 761 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.8537  9.40672  1.27909  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.6647  9.40672  1.27909  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.2583  9.42775  1.28183  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2583  9.42775  1.28183  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.2011  9.42775  1.28183  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 731 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.2013  9.42775  1.28183  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.9169  9.42775  1.28183  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.0384  9.41617  1.27605  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.0384  9.41617  1.27605  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9626  9.41617  1.27605  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 725 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.9631  9.41617  1.27605  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.5629  9.41617  1.27605  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.6046  9.40844  1.27787  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.6046  9.40844  1.27787  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2062  9.40844  1.27787  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 717 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.9098  9.40844  1.27787  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.0569  9.40844  1.28283  0.55
protocols.relax.FastRelax: {0} MRP: 4  -28.0569  -28.0573  9.40672  1.27909
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.0569  9.40844  1.28283  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.0569  9.40844  1.28283  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_40.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14894.4  6.95135  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14894.4  6.95135  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1939.82  6.95135  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 562 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  60.2545  6.95135  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  63.5423  6.95135  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  63.3367  6.95733  0.0175058  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  63.3367  6.95733  0.0175058  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  126.265  6.95733  0.0175058  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 545 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  121.404  6.95733  0.0175058  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  125.314  6.95733  0.0175058  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.741  7.93917  4.18652  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.741  7.93917  4.18652  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7335  7.93917  4.18652  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 605 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.7222  7.93917  4.18652  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.177  7.93917  4.18652  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.2385  7.93999  4.18461  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2385  7.93999  4.18461  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.967  7.93999  4.18461  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 600 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.991  7.93999  4.18461  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.4261  8.57247  4.45828  0.55
protocols.relax.FastRelax: {0} MRP: 0  -22.4261  -22.4261  8.57247  4.45828
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.4261  8.57247  4.45828  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.4261  8.57247  4.45828  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.4261  8.57247  4.45828  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.7403  8.57247  4.45828  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.4434  8.57247  4.45828  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.2675  8.57247  4.45828  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.9858  8.52359  4.68814  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.9858  8.52359  4.68814  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.0582  8.52359  4.68814  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6104  8.52359  4.68814  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.6537  8.52359  4.68814  0.154
protocols.relax.FastRelax: {0} CMD: min  -36.0565  8.60805  4.75451  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.0565  8.60805  4.75451  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2482  8.60805  4.75451  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 600 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.27  8.60805  4.75451  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6547  8.60805  4.75451  0.31955
protocols.relax.FastRelax: {0} CMD: min  -28.0367  8.6077  4.76291  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.0367  8.6077  4.76291  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.8972  8.6077  4.76291  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 598 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.946  8.6077  4.76291  0.55
protocols.relax.FastRelax: {0} CMD: min  -24.6318  8.77508  5.13763  0.55
protocols.relax.FastRelax: {0} MRP: 1  -24.6318  -24.6318  8.77508  5.13763
protocols.relax.FastRelax: {0} CMD: accept_to_best  -24.6318  8.77508  5.13763  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -24.6318  8.77508  5.13763  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.6318  8.77508  5.13763  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.9834  8.77508  5.13763  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.3098  8.77508  5.13763  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1373  8.77508  5.13763  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.6285  8.67703  5.14247  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.6285  8.67703  5.14247  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.051  8.67703  5.14247  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 605 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.0041  8.67703  5.14247  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.1541  8.67703  5.14247  0.154
protocols.relax.FastRelax: {0} CMD: min  -37.145  8.76534  5.2012  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.145  8.76534  5.2012  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4006  8.76534  5.2012  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.4394  8.76534  5.2012  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.9138  8.76534  5.2012  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.5462  8.76967  5.18806  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.5462  8.76967  5.18806  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.2434  8.76967  5.18806  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 593 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.2519  8.76967  5.18806  0.55
protocols.relax.FastRelax: {0} CMD: min  -24.6041  8.91631  5.39008  0.55
protocols.relax.FastRelax: {0} MRP: 2  -24.6041  -24.6318  8.77508  5.13763
protocols.relax.FastRelax: {0} CMD: accept_to_best  -24.6041  8.91631  5.39008  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -24.6041  8.91631  5.39008  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.6041  8.91631  5.39008  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1906  8.91631  5.39008  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 649 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.7024  8.91631  5.39008  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.5143  8.91631  5.39008  0.02805
protocols.relax.FastRelax: {0} CMD: min  -45.4712  8.82951  5.31053  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.4712  8.82951  5.31053  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.369  8.82951  5.31053  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.6455  8.82951  5.31053  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.8684  8.82951  5.31053  0.154
protocols.relax.FastRelax: {0} CMD: min  -35.6352  8.87611  5.41677  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.6352  8.87611  5.41677  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2613  8.87611  5.41677  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.9357  8.87611  5.41677  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.293  8.87611  5.41677  0.31955
protocols.relax.FastRelax: {0} CMD: min  -29.1005  8.91201  5.56027  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.1005  8.91201  5.56027  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.2054  8.91201  5.56027  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 595 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.6171  8.91201  5.56027  0.55
protocols.relax.FastRelax: {0} CMD: min  -24.7565  9.03094  5.36026  0.55
protocols.relax.FastRelax: {0} MRP: 3  -24.7565  -24.7565  9.03094  5.36026
protocols.relax.FastRelax: {0} CMD: accept_to_best  -24.7565  9.03094  5.36026  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -24.7565  9.03094  5.36026  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.7565  9.03094  5.36026  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1924  9.03094  5.36026  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.5223  9.03094  5.36026  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.3487  9.03094  5.36026  0.02805
protocols.relax.FastRelax: {0} CMD: min  -45.1586  8.91131  5.29752  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.1586  8.91131  5.29752  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.816  8.91131  5.29752  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.779  8.91131  5.29752  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.975  8.91131  5.29752  0.154
protocols.relax.FastRelax: {0} CMD: min  -37.5533  9.00587  5.42698  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.5533  9.00587  5.42698  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4105  9.00587  5.42698  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.4395  9.00587  5.42698  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.8825  9.00587  5.42698  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.2822  9.00351  5.45025  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.2822  9.00351  5.45025  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.0974  9.00351  5.45025  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 599 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.1531  9.00351  5.45025  0.55
protocols.relax.FastRelax: {0} CMD: min  -24.7608  9.042  5.39377  0.55
protocols.relax.FastRelax: {0} MRP: 4  -24.7608  -24.7608  9.042  5.39377
protocols.relax.FastRelax: {0} CMD: accept_to_best  -24.7608  9.042  5.39377  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -24.7608  9.042  5.39377  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_42.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13035.5  7.34355  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13035.5  7.34355  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1835.47  7.34355  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  54.1744  7.34355  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  58.6558  7.34355  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -27.1548  7.90168  3.79488  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.1548  7.90168  3.79488  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.68147  7.90168  3.79488  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.02532  7.90168  3.79488  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.823  7.90168  3.79488  0.154
protocols.relax.FastRelax: {0} CMD: min  -19.7681  7.98525  3.93499  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.7681  7.98525  3.93499  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.3973  7.98525  3.93499  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.5835  7.98525  3.93499  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.84961  7.98525  3.93499  0.31955
protocols.relax.FastRelax: {0} CMD: min  -9.88714  7.98674  3.93433  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.88714  7.98674  3.93433  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.0404  7.98674  3.93433  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  3.36228  7.98674  3.93433  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.0002  9.9559  7.04618  0.55
protocols.relax.FastRelax: {0} MRP: 0  -17.0002  -17.0002  9.9559  7.04618
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.0002  9.9559  7.04618  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.0002  9.9559  7.04618  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.0002  9.9559  7.04618  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.8946  9.9559  7.04618  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 649 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.6467  9.9559  7.04618  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.1827  9.9559  7.04618  0.02805
protocols.relax.FastRelax: {0} CMD: min  -36.2167  9.95392  7.04377  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.2167  9.95392  7.04377  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.1985  9.95392  7.04377  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.9148  9.95392  7.04377  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.5613  9.95392  7.04377  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.5843  9.95219  7.04148  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.5843  9.95219  7.04148  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0108  9.95219  7.04148  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.699  9.95219  7.04148  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3284  9.95219  7.04148  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.3366  9.95123  7.04025  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.3366  9.95123  7.04025  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.2754  9.95123  7.04025  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.2755  9.95123  7.04025  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.2155  10.0751  7.28173  0.55
protocols.relax.FastRelax: {0} MRP: 1  -20.2155  -20.2155  10.0751  7.28173
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.2155  10.0751  7.28173  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.2155  10.0751  7.28173  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.2155  10.0751  7.28173  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.2006  10.0751  7.28173  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.9403  10.0751  7.28173  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.4833  10.0751  7.28173  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.5177  10.0731  7.27925  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.5177  10.0731  7.27925  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.6366  10.0731  7.27925  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.2361  10.0731  7.27925  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.8851  10.0731  7.27925  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.9089  10.0713  7.27688  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.9089  10.0713  7.27688  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3824  10.0713  7.27688  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0368  10.0713  7.27688  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.668  10.0713  7.27688  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.676  10.0702  7.27553  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.676  10.0702  7.27553  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.6484  10.0702  7.27553  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 624 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.6484  10.0702  7.27553  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.2136  10.0843  7.30457  0.55
protocols.relax.FastRelax: {0} MRP: 2  -20.2136  -20.2155  10.0751  7.28173
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.2136  10.0843  7.30457  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.2136  10.0843  7.30457  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.2136  10.0843  7.30457  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.1936  10.0843  7.30457  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.6765  10.0843  7.30457  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.1704  10.0843  7.30457  0.02805
protocols.relax.FastRelax: {0} CMD: min  -36.209  10.0823  7.30215  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.209  10.0823  7.30215  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4024  10.0823  7.30215  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.7509  10.0823  7.30215  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.4017  10.0823  7.30215  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.4248  10.0805  7.2998  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.4248  10.0805  7.2998  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.9314  10.0805  7.2998  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.2702  10.0805  7.2998  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.8826  10.0805  7.2998  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.9128  10.0799  7.29883  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.9128  10.0799  7.29883  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.5418  10.0799  7.29883  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 624 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.1048  10.0799  7.29883  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.2173  10.0772  7.29295  0.55
protocols.relax.FastRelax: {0} MRP: 3  -20.2173  -20.2173  10.0772  7.29295
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.2173  10.0772  7.29295  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.2173  10.0772  7.29295  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.2173  10.0772  7.29295  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.2226  10.0772  7.29295  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 640 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.0106  10.0772  7.29295  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.5692  10.0772  7.29295  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.6031  10.0751  7.29047  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.6031  10.0751  7.29047  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.0247  10.0751  7.29047  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.9362  10.0751  7.29047  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.619  10.0751  7.29047  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.6356  10.073  7.28785  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.6356  10.073  7.28785  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7321  10.073  7.28785  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0072  10.073  7.28785  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.6358  10.073  7.28785  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.6445  10.0719  7.28652  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.6445  10.0719  7.28652  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.5676  10.0719  7.28652  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 623 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.5677  10.0719  7.28652  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.2207  10.0678  7.28333  0.55
protocols.relax.FastRelax: {0} MRP: 4  -20.2207  -20.2207  10.0678  7.28333
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.2207  10.0678  7.28333  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.2207  10.0678  7.28333  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_38.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15867.2  8.65939  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15867.2  8.65939  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1936.54  8.65939  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 583 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  44.8984  8.65939  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  49.6973  8.65939  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -36.164  7.96712  3.76216  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.164  7.96712  3.76216  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.5055  7.96712  3.76216  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.2797  7.96712  3.76216  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.2483  7.96712  3.76216  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.0211  7.86217  5.14391  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.0211  7.86217  5.14391  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.8251  7.86217  5.14391  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.7304  7.86217  5.14391  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.0572  7.86217  5.14391  0.31955
protocols.relax.FastRelax: {0} CMD: min  -29.6971  7.79344  5.6267  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.6971  7.79344  5.6267  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.9158  7.79344  5.6267  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.9841  7.79344  5.6267  0.55
protocols.relax.FastRelax: {0} CMD: min  -34.1406  8.80976  7.6924  0.55
protocols.relax.FastRelax: {0} MRP: 0  -34.1406  -34.1406  8.80976  7.6924
protocols.relax.FastRelax: {0} CMD: accept_to_best  -34.1406  8.80976  7.6924  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -34.1406  8.80976  7.6924  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.1406  8.80976  7.6924  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.8338  8.80976  7.6924  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.2019  8.80976  7.6924  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.9137  8.80976  7.6924  0.02805
protocols.relax.FastRelax: {0} CMD: min  -50.007  8.81512  7.70172  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.007  8.81512  7.70172  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.3839  8.81512  7.70172  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -45.4497  8.81512  7.70172  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -45.183  8.81512  7.70172  0.154
protocols.relax.FastRelax: {0} CMD: min  -45.2253  8.81708  7.7058  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.2253  8.81708  7.7058  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.2614  8.81708  7.7058  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.8071  8.81708  7.7058  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.479  8.81708  7.7058  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.5129  8.81305  7.7038  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.5129  8.81305  7.7038  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.2761  8.81305  7.7038  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.2761  8.81305  7.7038  0.55
protocols.relax.FastRelax: {0} CMD: min  -37.9276  9.03543  8.10774  0.55
protocols.relax.FastRelax: {0} MRP: 1  -37.9276  -37.9276  9.03543  8.10774
protocols.relax.FastRelax: {0} CMD: accept_to_best  -37.9276  9.03543  8.10774  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -37.9276  9.03543  8.10774  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.9276  9.03543  8.10774  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -51.8545  9.03543  8.10774  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 711 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -52.4284  9.03543  8.10774  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.1775  9.03543  8.10774  0.02805
protocols.relax.FastRelax: {0} CMD: min  -52.2313  9.03514  8.11185  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.2313  9.03514  8.11185  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.3436  9.03514  8.11185  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 701 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.7178  9.03514  8.11185  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.4949  9.03514  8.11185  0.154
protocols.relax.FastRelax: {0} CMD: min  -48.5199  9.03451  8.11395  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.5199  9.03451  8.11395  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.3627  9.03451  8.11395  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.3627  9.03451  8.11395  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.0349  9.03451  8.11395  0.31955
protocols.relax.FastRelax: {0} CMD: min  -44.0413  9.03382  8.11412  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.0413  9.03382  8.11412  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.7907  9.03382  8.11412  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.7907  9.03382  8.11412  0.55
protocols.relax.FastRelax: {0} CMD: min  -37.9303  9.03612  8.11158  0.55
protocols.relax.FastRelax: {0} MRP: 2  -37.9303  -37.9303  9.03612  8.11158
protocols.relax.FastRelax: {0} CMD: accept_to_best  -37.9303  9.03612  8.11158  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -37.9303  9.03612  8.11158  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.9303  9.03612  8.11158  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -51.8737  9.03612  8.11158  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -52.4667  9.03612  8.11158  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.2171  9.03612  8.11158  0.02805
protocols.relax.FastRelax: {0} CMD: min  -52.2703  9.0358  8.11556  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.2703  9.0358  8.11556  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.4088  9.0358  8.11556  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.7378  9.0358  8.11556  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.5145  9.0358  8.11556  0.154
protocols.relax.FastRelax: {0} CMD: min  -48.5392  9.03514  8.11756  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.5392  9.03514  8.11756  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.3752  9.03514  8.11756  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 690 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.3752  9.03514  8.11756  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.0468  9.03514  8.11756  0.31955
protocols.relax.FastRelax: {0} CMD: min  -44.0531  9.03445  8.11765  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.0531  9.03445  8.11765  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.7923  9.03445  8.11765  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 681 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.7923  9.03445  8.11765  0.55
protocols.relax.FastRelax: {0} CMD: min  -37.9261  9.02312  8.10612  0.55
protocols.relax.FastRelax: {0} MRP: 3  -37.9261  -37.9303  9.03612  8.11158
protocols.relax.FastRelax: {0} CMD: accept_to_best  -37.9261  9.02312  8.10612  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -37.9261  9.02312  8.10612  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.9261  9.02312  8.10612  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -51.8428  9.02312  8.10612  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -52.411  9.02312  8.10612  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.1607  9.02312  8.10612  0.02805
protocols.relax.FastRelax: {0} CMD: min  -52.2137  9.02274  8.11013  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.2137  9.02274  8.11013  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.3384  9.02274  8.11013  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.714  9.02274  8.11013  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.4912  9.02274  8.11013  0.154
protocols.relax.FastRelax: {0} CMD: min  -48.5158  9.02205  8.11217  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.5158  9.02205  8.11217  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.3607  9.02205  8.11217  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 690 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.3607  9.02205  8.11217  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.0331  9.02205  8.11217  0.31955
protocols.relax.FastRelax: {0} CMD: min  -44.0393  9.02133  8.11228  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.0393  9.02133  8.11228  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.7919  9.02133  8.11228  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 681 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.7919  9.02133  8.11228  0.55
protocols.relax.FastRelax: {0} CMD: min  -37.9322  9.02593  8.10668  0.55
protocols.relax.FastRelax: {0} MRP: 4  -37.9322  -37.9322  9.02593  8.10668
protocols.relax.FastRelax: {0} CMD: accept_to_best  -37.9322  9.02593  8.10668  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -37.9322  9.02593  8.10668  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_37.pdb
protocols.relax.FastRelax: {0} CMD: repeat  11844.2  8.11692  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  11844.2  8.11692  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1778.36  8.11692  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 585 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  103.809  8.11692  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  115.641  8.11692  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -8.2681  9.1238  3.97229  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.2681  9.1238  3.97229  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  17.9063  9.1238  3.97229  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  8.79418  9.1238  3.97229  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  10.2039  9.1238  3.97229  0.154
protocols.relax.FastRelax: {0} CMD: min  -18.1741  10.2723  5.24894  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.1741  10.2723  5.24894  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.6789  10.2723  5.24894  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 646 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.6824  10.2723  5.24894  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.0919  10.2723  5.24894  0.31955
protocols.relax.FastRelax: {0} CMD: min  -10.4501  10.2428  5.22445  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.4501  10.2428  5.22445  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.111942  10.2428  5.22445  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.640605  10.2428  5.22445  0.55
protocols.relax.FastRelax: {0} CMD: min  -12.707  9.88055  4.88596  0.55
protocols.relax.FastRelax: {0} MRP: 0  -12.707  -12.707  9.88055  4.88596
protocols.relax.FastRelax: {0} CMD: accept_to_best  -12.707  9.88055  4.88596  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -12.707  9.88055  4.88596  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.707  9.88055  4.88596  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3145  9.88055  4.88596  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.9204  9.88055  4.88596  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.6723  9.88055  4.88596  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.3586  10.1225  5.11305  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.3586  10.1225  5.11305  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.9588  10.1225  5.11305  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.7027  10.1225  5.11305  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.9214  10.1225  5.11305  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.9398  9.94202  4.9387  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9398  9.94202  4.9387  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.3156  9.94202  4.9387  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.3326  9.94202  4.9387  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.8143  9.94202  4.9387  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.5139  9.90357  4.92843  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.5139  9.90357  4.92843  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.2065  9.90357  4.92843  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.2068  9.90357  4.92843  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6264  9.72091  5.04907  0.55
protocols.relax.FastRelax: {0} MRP: 1  -17.6264  -17.6264  9.72091  5.04907
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6264  9.72091  5.04907  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6264  9.72091  5.04907  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6264  9.72091  5.04907  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1391  9.72091  5.04907  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.4785  9.72091  5.04907  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.1212  9.72091  5.04907  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.8115  9.78173  5.02642  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.8115  9.78173  5.02642  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.3646  9.78173  5.02642  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.2546  9.78173  5.02642  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7182  9.78173  5.02642  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.9256  9.76283  5.03942  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9256  9.76283  5.03942  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4839  9.76283  5.03942  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.4841  9.76283  5.03942  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.8973  9.76283  5.03942  0.31955
protocols.relax.FastRelax: {0} CMD: min  -22.6503  9.73183  5.02641  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.6503  9.73183  5.02641  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.7303  9.73183  5.02641  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 646 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.7592  9.73183  5.02641  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6351  9.71087  5.03591  0.55
protocols.relax.FastRelax: {0} MRP: 2  -17.6351  -17.6351  9.71087  5.03591
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6351  9.71087  5.03591  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6351  9.71087  5.03591  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6351  9.71087  5.03591  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1503  9.71087  5.03591  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.5234  9.71087  5.03591  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.1723  9.71087  5.03591  0.02805
protocols.relax.FastRelax: {0} CMD: min  -38.3711  9.82555  5.1264  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.3711  9.82555  5.1264  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.064  9.82555  5.1264  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.108  9.82555  5.1264  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.1544  9.82555  5.1264  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.7455  9.75644  5.06921  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.7455  9.75644  5.06921  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.7325  9.75644  5.06921  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 667 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.7497  9.75644  5.06921  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.1206  9.75644  5.06921  0.31955
protocols.relax.FastRelax: {0} CMD: min  -18.8652  9.70984  5.03382  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.8652  9.70984  5.03382  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.3066  9.70984  5.03382  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 660 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.30679  9.70984  5.03382  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6358  9.7144  5.04678  0.55
protocols.relax.FastRelax: {0} MRP: 3  -17.6358  -17.6358  9.7144  5.04678
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6358  9.7144  5.04678  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6358  9.7144  5.04678  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6358  9.7144  5.04678  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1673  9.7144  5.04678  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.5486  9.7144  5.04678  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.1895  9.7144  5.04678  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.4092  9.77215  4.98803  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.4092  9.77215  4.98803  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.5483  9.77215  4.98803  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 649 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.198  9.77215  4.98803  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.4325  9.77215  4.98803  0.154
protocols.relax.FastRelax: {0} CMD: min  -28.2551  9.73769  5.02654  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.2551  9.73769  5.02654  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.395  9.73769  5.02654  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 649 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.6019  9.73769  5.02654  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.1303  9.73769  5.02654  0.31955
protocols.relax.FastRelax: {0} CMD: min  -22.5756  9.71458  5.01514  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.5756  9.71458  5.01514  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.6399  9.71458  5.01514  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.646  9.71458  5.01514  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6405  9.71385  5.04012  0.55
protocols.relax.FastRelax: {0} MRP: 4  -17.6405  -17.6405  9.71385  5.04012
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6405  9.71385  5.04012  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6405  9.71385  5.04012  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_31.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16509.6  9.91003  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16509.6  9.91003  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2500.04  9.91003  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  56.1602  9.91003  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  60.0416  9.91003  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -38.0092  10.2647  3.71993  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.0092  10.2647  3.71993  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.5098  10.2647  3.71993  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 595 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.6564  10.2647  3.71993  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.3784  10.2647  3.71993  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.2651  10.3029  4.21116  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.2651  10.3029  4.21116  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7739  10.3029  4.21116  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 606 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.2688  10.3029  4.21116  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.547  10.3029  4.21116  0.31955
protocols.relax.FastRelax: {0} CMD: min  -31.0319  10.2945  4.2021  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.0319  10.2945  4.2021  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.2737  10.2945  4.2021  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 599 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.2825  10.2945  4.2021  0.55
protocols.relax.FastRelax: {0} CMD: min  -29.4512  10.2145  4.20173  0.55
protocols.relax.FastRelax: {0} MRP: 0  -29.4512  -29.4512  10.2145  4.20173
protocols.relax.FastRelax: {0} CMD: accept_to_best  -29.4512  10.2145  4.20173  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -29.4512  10.2145  4.20173  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.4512  10.2145  4.20173  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.556  10.2145  4.20173  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.9557  10.2145  4.20173  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.1224  10.2145  4.20173  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.7112  10.2796  4.17227  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.7112  10.2796  4.17227  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.2295  10.2796  4.17227  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 615 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.6237  10.2796  4.17227  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.8356  10.2796  4.17227  0.154
protocols.relax.FastRelax: {0} CMD: min  -45.8563  10.2185  4.14034  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.8563  10.2185  4.14034  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.2872  10.2185  4.14034  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 595 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.2885  10.2185  4.14034  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.6131  10.2185  4.14034  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.0598  10.2161  4.15589  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.0598  10.2161  4.15589  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.8263  10.2161  4.15589  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 592 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.8598  10.2161  4.15589  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.7279  10.2343  4.39437  0.55
protocols.relax.FastRelax: {0} MRP: 1  -30.7279  -30.7279  10.2343  4.39437
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.7279  10.2343  4.39437  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.7279  10.2343  4.39437  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.7279  10.2343  4.39437  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.7698  10.2343  4.39437  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.7445  10.2343  4.39437  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.7403  10.2343  4.39437  0.02805
protocols.relax.FastRelax: {0} CMD: min  -59.2615  10.2462  4.39093  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -59.2615  10.2462  4.39093  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.4924  10.2462  4.39093  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 628 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.7327  10.2462  4.39093  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.5071  10.2462  4.39093  0.154
protocols.relax.FastRelax: {0} CMD: min  -47.2324  10.2259  4.26926  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.2324  10.2259  4.26926  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.3731  10.2259  4.26926  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 613 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.8182  10.2259  4.26926  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.0314  10.2259  4.26926  0.31955
protocols.relax.FastRelax: {0} CMD: min  -37.994  10.1997  4.26293  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.994  10.1997  4.26293  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.8595  10.1997  4.26293  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 611 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.8595  10.1997  4.26293  0.55
protocols.relax.FastRelax: {0} CMD: min  -32.5456  10.1613  4.0824  0.55
protocols.relax.FastRelax: {0} MRP: 2  -32.5456  -32.5456  10.1613  4.0824
protocols.relax.FastRelax: {0} CMD: accept_to_best  -32.5456  10.1613  4.0824  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -32.5456  10.1613  4.0824  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.5456  10.1613  4.0824  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.5925  10.1613  4.0824  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -51.0362  10.1613  4.0824  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.2097  10.1613  4.0824  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.9255  10.203  4.13002  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.9255  10.203  4.13002  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.8865  10.203  4.13002  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 619 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.4516  10.203  4.13002  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.6511  10.203  4.13002  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.5893  10.1959  4.14238  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.5893  10.1959  4.14238  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.7474  10.1959  4.14238  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 598 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.7474  10.1959  4.14238  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.129  10.1959  4.14238  0.31955
protocols.relax.FastRelax: {0} CMD: min  -39.5574  10.1622  4.08608  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.5574  10.1622  4.08608  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2256  10.1622  4.08608  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 592 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.2284  10.1622  4.08608  0.55
protocols.relax.FastRelax: {0} CMD: min  -32.6465  10.1627  4.09999  0.55
protocols.relax.FastRelax: {0} MRP: 3  -32.6465  -32.6465  10.1627  4.09999
protocols.relax.FastRelax: {0} CMD: accept_to_best  -32.6465  10.1627  4.09999  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -32.6465  10.1627  4.09999  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.6465  10.1627  4.09999  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.6476  10.1627  4.09999  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.5561  10.1627  4.09999  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.6705  10.1627  4.09999  0.02805
protocols.relax.FastRelax: {0} CMD: min  -58.0776  10.1738  4.11061  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -58.0776  10.1738  4.11061  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.0442  10.1738  4.11061  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 602 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.8732  10.1738  4.11061  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.7336  10.1738  4.11061  0.154
protocols.relax.FastRelax: {0} CMD: min  -47.6928  10.1625  4.10002  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.6928  10.1625  4.10002  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.0672  10.1625  4.10002  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.0998  10.1625  4.10002  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.4162  10.1625  4.10002  0.31955
protocols.relax.FastRelax: {0} CMD: min  -39.3871  10.1408  4.10286  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.3871  10.1408  4.10286  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.027  10.1408  4.10286  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 591 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.1443  10.1408  4.10286  0.55
protocols.relax.FastRelax: {0} CMD: min  -32.6563  10.1616  4.08999  0.55
protocols.relax.FastRelax: {0} MRP: 4  -32.6563  -32.6563  10.1616  4.08999
protocols.relax.FastRelax: {0} CMD: accept_to_best  -32.6563  10.1616  4.08999  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -32.6563  10.1616  4.08999  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_3.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14028  8.63802  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14028  8.63802  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1924.5  8.63802  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 571 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  123.747  8.63802  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  132.549  8.63802  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  9.04236  7.5811  4.25865  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  9.04236  7.5811  4.25865  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  27.7446  7.5811  4.25865  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  26.4204  7.5811  4.25865  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  27.6975  7.5811  4.25865  0.154
protocols.relax.FastRelax: {0} CMD: min  15.3689  7.44366  4.73812  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15.3689  7.44366  4.73812  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  25.9449  7.44366  4.73812  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 601 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  23.0207  7.44366  4.73812  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  23.8022  7.44366  4.73812  0.31955
protocols.relax.FastRelax: {0} CMD: min  12.9347  7.68236  4.26892  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  12.9347  7.68236  4.26892  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  21.4471  7.68236  4.26892  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 582 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  21.3649  7.68236  4.26892  0.55
protocols.relax.FastRelax: {0} CMD: min  6.56084  6.62511  7.14687  0.55
protocols.relax.FastRelax: {0} MRP: 0  6.56084  6.56084  6.62511  7.14687
protocols.relax.FastRelax: {0} CMD: accept_to_best  6.56084  6.62511  7.14687  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  6.56084  6.62511  7.14687  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  6.56084  6.62511  7.14687  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.2564  6.62511  7.14687  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 694 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.9143  6.62511  7.14687  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.5124  6.62511  7.14687  0.02805
protocols.relax.FastRelax: {0} CMD: min  -19.5486  6.47204  7.73211  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.5486  6.47204  7.73211  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.89811  6.47204  7.73211  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.92035  6.47204  7.73211  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.684824  6.47204  7.73211  0.154
protocols.relax.FastRelax: {0} CMD: min  -10.2431  6.56522  7.37153  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.2431  6.56522  7.37153  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.89946  6.56522  7.37153  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.90105  6.56522  7.37153  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.24323  6.56522  7.37153  0.31955
protocols.relax.FastRelax: {0} CMD: min  -3.49245  6.60188  7.16467  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -3.49245  6.60188  7.16467  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  5.16554  6.60188  7.16467  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 669 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  5.16554  6.60188  7.16467  0.55
protocols.relax.FastRelax: {0} CMD: min  3.85839  6.61155  7.20535  0.55
protocols.relax.FastRelax: {0} MRP: 1  3.85839  3.85839  6.61155  7.20535
protocols.relax.FastRelax: {0} CMD: accept_to_best  3.85839  6.61155  7.20535  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  3.85839  6.61155  7.20535  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  3.85839  6.61155  7.20535  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.9861  6.61155  7.20535  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.5243  6.61155  7.20535  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.3279  6.61155  7.20535  0.02805
protocols.relax.FastRelax: {0} CMD: min  -19.3716  6.45718  7.7916  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.3716  6.45718  7.7916  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.25804  6.45718  7.7916  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -3.2796  6.45718  7.7916  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.14906  6.45718  7.7916  0.154
protocols.relax.FastRelax: {0} CMD: min  -8.83922  6.49591  7.53953  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.83922  6.49591  7.53953  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  0.64585  6.49591  7.53953  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  0.6435  6.49591  7.53953  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.39123  6.49591  7.53953  0.31955
protocols.relax.FastRelax: {0} CMD: min  -3.64204  6.58697  7.24851  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -3.64204  6.58697  7.24851  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.98208  6.58697  7.24851  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  4.96173  6.58697  7.24851  0.55
protocols.relax.FastRelax: {0} CMD: min  3.78949  6.60875  7.20345  0.55
protocols.relax.FastRelax: {0} MRP: 2  3.78949  3.78949  6.60875  7.20345
protocols.relax.FastRelax: {0} CMD: accept_to_best  3.78949  6.60875  7.20345  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  3.78949  6.60875  7.20345  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  3.78949  6.60875  7.20345  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.9456  6.60875  7.20345  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.5023  6.60875  7.20345  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.3056  6.60875  7.20345  0.02805
protocols.relax.FastRelax: {0} CMD: min  -20.1305  6.46565  7.75546  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.1305  6.46565  7.75546  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.61641  6.46565  7.75546  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 653 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -3.61641  6.46565  7.75546  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.45888  6.46565  7.75546  0.154
protocols.relax.FastRelax: {0} CMD: min  -10.7454  6.5387  7.44267  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.7454  6.5387  7.44267  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.44432  6.5387  7.44267  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.44432  6.5387  7.44267  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.78975  6.5387  7.44267  0.31955
protocols.relax.FastRelax: {0} CMD: min  -3.59542  6.58903  7.21065  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -3.59542  6.58903  7.21065  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  5.30019  6.58903  7.21065  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  5.28091  6.58903  7.21065  0.55
protocols.relax.FastRelax: {0} CMD: min  3.7899  6.61368  7.20529  0.55
protocols.relax.FastRelax: {0} MRP: 3  3.7899  3.78949  6.60875  7.20345
protocols.relax.FastRelax: {0} CMD: accept_to_best  3.7899  6.61368  7.20529  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  3.7899  6.61368  7.20529  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  3.7899  6.61368  7.20529  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.9728  6.61368  7.20529  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.5331  6.61368  7.20529  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.336  6.61368  7.20529  0.02805
protocols.relax.FastRelax: {0} CMD: min  -19.5222  6.45218  7.77262  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.5222  6.45218  7.77262  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.48865  6.45218  7.77262  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 669 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -3.48963  6.45218  7.77262  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.36598  6.45218  7.77262  0.154
protocols.relax.FastRelax: {0} CMD: min  -10.6655  6.51881  7.46435  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.6655  6.51881  7.46435  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.52773  6.51881  7.46435  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 692 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.52773  6.51881  7.46435  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.88604  6.51881  7.46435  0.31955
protocols.relax.FastRelax: {0} CMD: min  -3.67583  6.5983  7.22213  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -3.67583  6.5983  7.22213  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.9371  6.5983  7.22213  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 688 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  4.90211  6.5983  7.22213  0.55
protocols.relax.FastRelax: {0} CMD: min  3.79002  6.61481  7.20516  0.55
protocols.relax.FastRelax: {0} MRP: 4  3.79002  3.78949  6.60875  7.20345
protocols.relax.FastRelax: {0} CMD: accept_to_best  3.79002  6.61481  7.20516  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  3.79002  6.61481  7.20516  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_15.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13540.7  8.62467  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13540.7  8.62467  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2122.69  8.62467  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  71.8173  8.62467  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  73.4166  8.62467  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -18.3822  9.55107  4.01507  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.3822  9.55107  4.01507  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  5.4685  9.55107  4.01507  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.1411  9.55107  4.01507  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.4924  9.55107  4.01507  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.9079  8.83229  3.4664  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9079  8.83229  3.4664  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7757  8.83229  3.4664  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 623 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.9104  8.83229  3.4664  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.431  8.83229  3.4664  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.7039  8.81863  3.45155  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.7039  8.81863  3.45155  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.0507  8.81863  3.45155  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 614 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.0801  8.81863  3.45155  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.3052  8.42721  3.28692  0.55
protocols.relax.FastRelax: {0} MRP: 0  -21.3052  -21.3052  8.42721  3.28692
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.3052  8.42721  3.28692  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.3052  8.42721  3.28692  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.3052  8.42721  3.28692  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4273  8.42721  3.28692  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.0579  8.42721  3.28692  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.5415  8.42721  3.28692  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.118  8.45186  3.30678  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.118  8.45186  3.30678  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.2899  8.45186  3.30678  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 665 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6642  8.45186  3.30678  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4207  8.45186  3.30678  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.4612  8.45126  3.30798  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.4612  8.45126  3.30798  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.947  8.45126  3.30798  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.947  8.45126  3.30798  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.591  8.45126  3.30798  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.8308  8.43636  3.28667  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.8308  8.43636  3.28667  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.5873  8.43636  3.28667  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 649 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.5873  8.43636  3.28667  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2259  8.48971  3.16324  0.55
protocols.relax.FastRelax: {0} MRP: 1  -21.2259  -21.3052  8.42721  3.28692
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2259  8.48971  3.16324  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2259  8.48971  3.16324  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2259  8.48971  3.16324  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.3284  8.48971  3.16324  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 664 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.6964  8.48971  3.16324  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1441  8.48971  3.16324  0.02805
protocols.relax.FastRelax: {0} CMD: min  -33.7435  8.51054  3.18358  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.7435  8.51054  3.18358  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.2696  8.51054  3.18358  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 652 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.9399  8.51054  3.18358  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7157  8.51054  3.18358  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.7455  8.50822  3.18445  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.7455  8.50822  3.18445  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.5752  8.50822  3.18445  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.5752  8.50822  3.18445  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2464  8.50822  3.18445  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.4192  8.48796  3.16354  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.4192  8.48796  3.16354  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.6519  8.48796  3.16354  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.6519  8.48796  3.16354  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2233  8.49523  3.16733  0.55
protocols.relax.FastRelax: {0} MRP: 2  -21.2233  -21.3052  8.42721  3.28692
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2233  8.49523  3.16733  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2233  8.49523  3.16733  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2233  8.49523  3.16733  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.336  8.49523  3.16733  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.5986  8.49523  3.16733  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4514  8.49523  3.16733  0.02805
protocols.relax.FastRelax: {0} CMD: min  -38.2607  8.50555  3.33766  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.2607  8.50555  3.33766  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.6093  8.50555  3.33766  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.6398  8.50555  3.33766  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.9654  8.50555  3.33766  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.9552  8.50533  3.26095  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.9552  8.50533  3.26095  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9361  8.50533  3.26095  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9745  8.50533  3.26095  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5016  8.50533  3.26095  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.4701  8.50363  3.24048  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.4701  8.50363  3.24048  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.1429  8.50363  3.24048  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 616 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.1432  8.50363  3.24048  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2181  8.50259  3.18898  0.55
protocols.relax.FastRelax: {0} MRP: 3  -21.2181  -21.3052  8.42721  3.28692
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2181  8.50259  3.18898  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2181  8.50259  3.18898  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2181  8.50259  3.18898  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.3874  8.50259  3.18898  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.7112  8.50259  3.18898  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.5439  8.50259  3.18898  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.8397  8.49583  3.17985  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.8397  8.49583  3.17985  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.5235  8.49583  3.17985  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.4287  8.49583  3.17985  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2309  8.49583  3.17985  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.9236  8.50819  3.20736  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.9236  8.50819  3.20736  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.7433  8.50819  3.20736  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.7433  8.50819  3.20736  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4137  8.50819  3.20736  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.5156  8.49573  3.19222  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.5156  8.49573  3.19222  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5881  8.49573  3.19222  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.5881  8.49573  3.19222  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2227  8.5119  3.20332  0.55
protocols.relax.FastRelax: {0} MRP: 4  -21.2227  -21.3052  8.42721  3.28692
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2227  8.5119  3.20332  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2227  8.5119  3.20332  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_29.pdb
protocols.relax.FastRelax: {0} CMD: repeat  12542.7  7.6303  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  12542.7  7.6303  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1771.47  7.6303  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 551 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  61.8981  7.6303  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  68.8675  7.6303  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -30.1972  7.67808  3.90593  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.1972  7.67808  3.90593  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.89848  7.67808  3.90593  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.7647  7.67808  3.90593  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.24377  7.67808  3.90593  0.154
protocols.relax.FastRelax: {0} CMD: min  -20.1956  7.74143  3.91658  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.1956  7.74143  3.91658  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.09167  7.74143  3.91658  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.12748  7.74143  3.91658  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.25366  7.74143  3.91658  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.8663  8.2198  5.26966  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.8663  8.2198  5.26966  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.9937  8.2198  5.26966  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 683 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.2705  8.2198  5.26966  0.55
protocols.relax.FastRelax: {0} CMD: min  -23.4908  9.23147  7.30422  0.55
protocols.relax.FastRelax: {0} MRP: 0  -23.4908  -23.4908  9.23147  7.30422
protocols.relax.FastRelax: {0} CMD: accept_to_best  -23.4908  9.23147  7.30422  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -23.4908  9.23147  7.30422  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.4908  9.23147  7.30422  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.984  9.23147  7.30422  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 812 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.883  9.23147  7.30422  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.6409  9.23147  7.30422  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.7747  9.22557  7.2965  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.7747  9.22557  7.2965  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.0247  9.22557  7.2965  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 765 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.0248  9.22557  7.2965  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.6918  9.22557  7.2965  0.154
protocols.relax.FastRelax: {0} CMD: min  -38.7448  9.22208  7.2919  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.7448  9.22208  7.2919  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.5226  9.22208  7.2919  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 742 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.5227  9.22208  7.2919  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.032  9.22208  7.2919  0.31955
protocols.relax.FastRelax: {0} CMD: min  -32.0518  9.22157  7.29111  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.0518  9.22157  7.29111  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.7109  9.22157  7.29111  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.7109  9.22157  7.29111  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.3116  9.59002  7.78126  0.55
protocols.relax.FastRelax: {0} MRP: 1  -26.3116  -26.3116  9.59002  7.78126
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.3116  9.59002  7.78126  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.3116  9.59002  7.78126  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.3116  9.59002  7.78126  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.2442  9.59002  7.78126  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 812 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.7043  9.59002  7.78126  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.4738  9.59002  7.78126  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.6199  9.58321  7.77222  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.6199  9.58321  7.77222  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.1002  9.58321  7.77222  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 764 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.1003  9.58321  7.77222  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.7835  9.58321  7.77222  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.8473  9.57892  7.76661  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.8473  9.57892  7.76661  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9224  9.57892  7.76661  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 743 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.9225  9.57892  7.76661  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4553  9.57892  7.76661  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.4678  9.57776  7.76517  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4678  9.57776  7.76517  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.5559  9.57776  7.76517  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.5559  9.57776  7.76517  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.311  9.60173  7.79  0.55
protocols.relax.FastRelax: {0} MRP: 2  -26.311  -26.3116  9.59002  7.78126
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.311  9.60173  7.79  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.311  9.60173  7.79  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.311  9.60173  7.79  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.2332  9.60173  7.79  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 811 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.6671  9.60173  7.79  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.4386  9.60173  7.79  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.5835  9.59493  7.78098  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.5835  9.59493  7.78098  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.1014  9.59493  7.78098  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 763 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.1015  9.59493  7.78098  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.7873  9.59493  7.78098  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.8503  9.59066  7.77539  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.8503  9.59066  7.77539  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9747  9.59066  7.77539  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 742 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.9748  9.59066  7.77539  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.5114  9.59066  7.77539  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.5235  9.58951  7.77396  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.5235  9.58951  7.77396  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.6854  9.58951  7.77396  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 711 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.6854  9.58951  7.77396  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.3162  9.59994  7.79174  0.55
protocols.relax.FastRelax: {0} MRP: 3  -26.3162  -26.3162  9.59994  7.79174
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.3162  9.59994  7.79174  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.3162  9.59994  7.79174  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.3162  9.59994  7.79174  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.2353  9.59994  7.79174  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 812 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.6859  9.59994  7.79174  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.4564  9.59994  7.79174  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.6018  9.59313  7.78271  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.6018  9.59313  7.78271  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.0993  9.59313  7.78271  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 764 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.0994  9.59313  7.78271  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.7838  9.59313  7.78271  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.8468  9.58884  7.77709  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.8468  9.58884  7.77709  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9447  9.58884  7.77709  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 743 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.9447  9.58884  7.77709  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4793  9.58884  7.77709  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.4916  9.58766  7.77562  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4916  9.58766  7.77562  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.6138  9.58766  7.77562  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.6138  9.58766  7.77562  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.317  9.60024  7.79122  0.55
protocols.relax.FastRelax: {0} MRP: 4  -26.317  -26.317  9.60024  7.79122
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.317  9.60024  7.79122  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.317  9.60024  7.79122  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_8.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14556.1  6.86966  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14556.1  6.86966  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2169.75  6.86966  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  153.78  6.86966  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  182.128  6.86966  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.4159  6.51461  3.50894  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.4159  6.51461  3.50894  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.396768  6.51461  3.50894  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 732 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.9024  6.51461  3.50894  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4471  6.51461  3.50894  0.154
protocols.relax.FastRelax: {0} CMD: min  -35.2042  6.49832  3.39261  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.2042  6.49832  3.39261  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2777  6.49832  3.39261  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 739 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.3146  6.49832  3.39261  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.5288  6.49832  3.39261  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.9454  6.50393  3.36527  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.9454  6.50393  3.36527  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7489  6.50393  3.36527  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 736 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7594  6.50393  3.36527  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.8057  6.57343  3.65422  0.55
protocols.relax.FastRelax: {0} MRP: 0  -26.8057  -26.8057  6.57343  3.65422
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.8057  6.57343  3.65422  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.8057  6.57343  3.65422  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.8057  6.57343  3.65422  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.0362  6.57343  3.65422  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 779 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.7778  6.57343  3.65422  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.4501  6.57343  3.65422  0.02805
protocols.relax.FastRelax: {0} CMD: min  -51.9601  6.6294  3.83085  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -51.9601  6.6294  3.83085  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2733  6.6294  3.83085  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 777 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6916  6.6294  3.83085  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.2848  6.6294  3.83085  0.154
protocols.relax.FastRelax: {0} CMD: min  -41.6182  6.60741  3.79805  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.6182  6.60741  3.79805  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.256  6.60741  3.79805  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 725 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.2983  6.60741  3.79805  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.5647  6.60741  3.79805  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.1432  6.61725  3.75555  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.1432  6.61725  3.75555  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.6743  6.61725  3.75555  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 721 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.6743  6.61725  3.75555  0.55
protocols.relax.FastRelax: {0} CMD: min  -31.4605  6.72282  4.18978  0.55
protocols.relax.FastRelax: {0} MRP: 1  -31.4605  -31.4605  6.72282  4.18978
protocols.relax.FastRelax: {0} CMD: accept_to_best  -31.4605  6.72282  4.18978  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -31.4605  6.72282  4.18978  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.4605  6.72282  4.18978  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -45.8468  6.72282  4.18978  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 855 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.3671  6.72282  4.18978  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.9399  6.72282  4.18978  0.02805
protocols.relax.FastRelax: {0} CMD: min  -59.9026  6.79919  4.53852  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -59.9026  6.79919  4.53852  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.484  6.79919  4.53852  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 772 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.366  6.79919  4.53852  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.1189  6.79919  4.53852  0.154
protocols.relax.FastRelax: {0} CMD: min  -45.9405  6.78563  4.49137  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.9405  6.78563  4.49137  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.532  6.78563  4.49137  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 752 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.6138  6.78563  4.49137  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.9302  6.78563  4.49137  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.6361  6.80842  4.52805  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.6361  6.80842  4.52805  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.3847  6.80842  4.52805  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 746 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.3946  6.80842  4.52805  0.55
protocols.relax.FastRelax: {0} CMD: min  -38.4348  7.40283  5.57672  0.55
protocols.relax.FastRelax: {0} MRP: 2  -38.4348  -38.4348  7.40283  5.57672
protocols.relax.FastRelax: {0} CMD: accept_to_best  -38.4348  7.40283  5.57672  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -38.4348  7.40283  5.57672  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.4348  7.40283  5.57672  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -53.8365  7.40283  5.57672  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 885 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -55.6913  7.40283  5.57672  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -55.2246  7.40283  5.57672  0.02805
protocols.relax.FastRelax: {0} CMD: min  -58.7422  7.38075  5.57955  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -58.7422  7.38075  5.57955  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.6258  7.38075  5.57955  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 766 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.7375  7.38075  5.57955  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.6517  7.38075  5.57955  0.154
protocols.relax.FastRelax: {0} CMD: min  -51.3133  7.48899  5.73124  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -51.3133  7.48899  5.73124  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.9109  7.48899  5.73124  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 737 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.9685  7.48899  5.73124  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.2262  7.48899  5.73124  0.31955
protocols.relax.FastRelax: {0} CMD: min  -42.0549  7.45051  5.68373  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.0549  7.45051  5.68373  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1718  7.45051  5.68373  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 729 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.7965  7.45051  5.68373  0.55
protocols.relax.FastRelax: {0} CMD: min  -41.9321  7.75144  6.10885  0.55
protocols.relax.FastRelax: {0} MRP: 3  -41.9321  -41.9321  7.75144  6.10885
protocols.relax.FastRelax: {0} CMD: accept_to_best  -41.9321  7.75144  6.10885  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -41.9321  7.75144  6.10885  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.9321  7.75144  6.10885  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -56.7592  7.75144  6.10885  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 899 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -58.4579  7.75144  6.10885  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -57.6538  7.75144  6.10885  0.02805
protocols.relax.FastRelax: {0} CMD: min  -62.1705  7.72638  6.15035  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -62.1705  7.72638  6.15035  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5454  7.72638  6.15035  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 758 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.7891  7.72638  6.15035  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.9632  7.72638  6.15035  0.154
protocols.relax.FastRelax: {0} CMD: min  -54.2744  7.88204  6.3221  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.2744  7.88204  6.3221  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.257  7.88204  6.3221  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 751 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -46.4419  7.88204  6.3221  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -45.8243  7.88204  6.3221  0.31955
protocols.relax.FastRelax: {0} CMD: min  -47.9442  7.79734  6.17603  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.9442  7.79734  6.17603  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1981  7.79734  6.17603  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 746 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.1982  7.79734  6.17603  0.55
protocols.relax.FastRelax: {0} CMD: min  -41.9377  7.77052  6.13454  0.55
protocols.relax.FastRelax: {0} MRP: 4  -41.9377  -41.9377  7.77052  6.13454
protocols.relax.FastRelax: {0} CMD: accept_to_best  -41.9377  7.77052  6.13454  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -41.9377  7.77052  6.13454  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_9.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14542  7.53711  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14542  7.53711  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1854.41  7.53711  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 648 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  56.4246  7.53711  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  61.105  7.53711  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -14.7786  7.62257  5.30642  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.7786  7.62257  5.30642  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  34.3268  7.62257  5.30642  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 611 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  29.6165  7.62257  5.30642  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  32.9517  7.62257  5.30642  0.154
protocols.relax.FastRelax: {0} CMD: min  -16.7282  7.35734  4.67673  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.7282  7.35734  4.67673  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.66663  7.35734  4.67673  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.9824  7.35734  4.67673  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.3798  7.35734  4.67673  0.31955
protocols.relax.FastRelax: {0} CMD: min  -11.4364  7.35401  4.68378  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.4364  7.35401  4.68378  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.0292778  7.35401  4.68378  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 664 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.610523  7.35401  4.68378  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.227  7.69283  3.72315  0.55
protocols.relax.FastRelax: {0} MRP: 0  -21.227  -21.227  7.69283  3.72315
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.227  7.69283  3.72315  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.227  7.69283  3.72315  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.227  7.69283  3.72315  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.0452  7.69283  3.72315  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.9014  7.69283  3.72315  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.4197  7.69283  3.72315  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.4956  7.69993  3.72786  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.4956  7.69993  3.72786  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1183  7.69993  3.72786  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.338  7.69993  3.72786  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.9251  7.69993  3.72786  0.154
protocols.relax.FastRelax: {0} CMD: min  -36.2473  7.68924  3.68515  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.2473  7.68924  3.68515  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.1606  7.68924  3.68515  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.8404  7.68924  3.68515  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.3625  7.68924  3.68515  0.31955
protocols.relax.FastRelax: {0} CMD: min  -32.9979  7.86222  4.21396  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.9979  7.86222  4.21396  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0313  7.86222  4.21396  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.0855  7.86222  4.21396  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.6456  7.92172  5.25016  0.55
protocols.relax.FastRelax: {0} MRP: 1  -30.6456  -30.6456  7.92172  5.25016
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.6456  7.92172  5.25016  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.6456  7.92172  5.25016  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.6456  7.92172  5.25016  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.9981  7.92172  5.25016  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 675 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.5209  7.92172  5.25016  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.0906  7.92172  5.25016  0.02805
protocols.relax.FastRelax: {0} CMD: min  -48.3343  7.93781  5.25819  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.3343  7.93781  5.25819  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.9555  7.93781  5.25819  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 660 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.9748  7.93781  5.25819  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.6386  7.93781  5.25819  0.154
protocols.relax.FastRelax: {0} CMD: min  -42.6896  7.93778  5.26846  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.6896  7.93778  5.26846  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.4782  7.93778  5.26846  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.4793  7.93778  5.26846  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.9899  7.93778  5.26846  0.31955
protocols.relax.FastRelax: {0} CMD: min  -37.0784  7.92853  5.25607  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.0784  7.92853  5.25607  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.8242  7.92853  5.25607  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 652 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.8245  7.92853  5.25607  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.7703  7.966  5.41865  0.55
protocols.relax.FastRelax: {0} MRP: 2  -30.7703  -30.7703  7.966  5.41865
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.7703  7.966  5.41865  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.7703  7.966  5.41865  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.7703  7.966  5.41865  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.9999  7.966  5.41865  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.1257  7.966  5.41865  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.7898  7.966  5.41865  0.02805
protocols.relax.FastRelax: {0} CMD: min  -48.9453  7.97871  5.42608  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.9453  7.97871  5.42608  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.3606  7.97871  5.42608  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.1237  7.97871  5.42608  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.7933  7.97871  5.42608  0.154
protocols.relax.FastRelax: {0} CMD: min  -42.8434  7.97985  5.435  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.8434  7.97985  5.435  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.7267  7.97985  5.435  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.7268  7.97985  5.435  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.2445  7.97985  5.435  0.31955
protocols.relax.FastRelax: {0} CMD: min  -37.3905  7.97998  5.43875  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.3905  7.97998  5.43875  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.1875  7.97998  5.43875  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.1876  7.97998  5.43875  0.55
protocols.relax.FastRelax: {0} CMD: min  -31.8335  7.90839  5.30456  0.55
protocols.relax.FastRelax: {0} MRP: 3  -31.8335  -31.8335  7.90839  5.30456
protocols.relax.FastRelax: {0} CMD: accept_to_best  -31.8335  7.90839  5.30456  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -31.8335  7.90839  5.30456  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.8335  7.90839  5.30456  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.1508  7.90839  5.30456  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -51.0746  7.90839  5.30456  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.6992  7.90839  5.30456  0.02805
protocols.relax.FastRelax: {0} CMD: min  -50.8851  7.92304  5.31394  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.8851  7.92304  5.31394  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.5273  7.92304  5.31394  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.5061  7.92304  5.31394  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.1727  7.92304  5.31394  0.154
protocols.relax.FastRelax: {0} CMD: min  -44.2344  7.92401  5.32408  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.2344  7.92401  5.32408  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.064  7.92401  5.32408  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.0641  7.92401  5.32408  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.5776  7.92401  5.32408  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.2969  7.93563  5.31701  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.2969  7.93563  5.31701  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.7688  7.93563  5.31701  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 648 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.7689  7.93563  5.31701  0.55
protocols.relax.FastRelax: {0} CMD: min  -32.3267  7.97063  5.48598  0.55
protocols.relax.FastRelax: {0} MRP: 4  -32.3267  -32.3267  7.97063  5.48598
protocols.relax.FastRelax: {0} CMD: accept_to_best  -32.3267  7.97063  5.48598  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -32.3267  7.97063  5.48598  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_43.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14307.7  8.27139  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14307.7  8.27139  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1804.6  8.27139  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  94.2085  8.27139  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  101.997  8.27139  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -10.37  8.35871  3.37028  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.37  8.35871  3.37028  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  12.3022  8.35871  3.37028  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  8.06917  8.35871  3.37028  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  9.34968  8.35871  3.37028  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.3001  8.72609  3.61081  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.3001  8.72609  3.61081  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.61193  8.72609  3.61081  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.85545  8.72609  3.61081  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.24527  8.72609  3.61081  0.31955
protocols.relax.FastRelax: {0} CMD: min  -13.1268  8.95372  3.82543  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.1268  8.95372  3.82543  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.29262  8.95372  3.82543  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.30658  8.95372  3.82543  0.55
protocols.relax.FastRelax: {0} CMD: min  -12.7482  8.6998  3.39696  0.55
protocols.relax.FastRelax: {0} MRP: 0  -12.7482  -12.7482  8.6998  3.39696
protocols.relax.FastRelax: {0} CMD: accept_to_best  -12.7482  8.6998  3.39696  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -12.7482  8.6998  3.39696  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.7482  8.6998  3.39696  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.5704  8.6998  3.39696  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.6916  8.6998  3.39696  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.4716  8.6998  3.39696  0.02805
protocols.relax.FastRelax: {0} CMD: min  -41.8353  8.86135  3.89538  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.8353  8.86135  3.89538  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.06  8.86135  3.89538  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.098  8.86135  3.89538  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.9349  8.86135  3.89538  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.8461  8.87438  3.8525  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.8461  8.87438  3.8525  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.6289  8.87438  3.8525  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 648 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.7523  8.87438  3.8525  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.1083  8.87438  3.8525  0.31955
protocols.relax.FastRelax: {0} CMD: min  -22.5791  8.87488  3.84694  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.5791  8.87488  3.84694  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.0486  8.87488  3.84694  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.0898  8.87488  3.84694  0.55
protocols.relax.FastRelax: {0} CMD: min  -23.1984  9.127  4.25337  0.55
protocols.relax.FastRelax: {0} MRP: 1  -23.1984  -23.1984  9.127  4.25337
protocols.relax.FastRelax: {0} CMD: accept_to_best  -23.1984  9.127  4.25337  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -23.1984  9.127  4.25337  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.1984  9.127  4.25337  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.5211  9.127  4.25337  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.7814  9.127  4.25337  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.5848  9.127  4.25337  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.9588  9.16368  4.30554  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.9588  9.16368  4.30554  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.9334  9.16368  4.30554  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.1471  9.16368  4.30554  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.2513  9.16368  4.30554  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.5699  9.11332  4.22561  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.5699  9.11332  4.22561  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.3955  9.11332  4.22561  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.5541  9.11332  4.22561  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.6858  9.11332  4.22561  0.31955
protocols.relax.FastRelax: {0} CMD: min  -29.0051  9.16212  4.28898  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.0051  9.16212  4.28898  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.5265  9.16212  4.28898  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.5265  9.16212  4.28898  0.55
protocols.relax.FastRelax: {0} CMD: min  -23.4581  9.09814  4.18481  0.55
protocols.relax.FastRelax: {0} MRP: 2  -23.4581  -23.4581  9.09814  4.18481
protocols.relax.FastRelax: {0} CMD: accept_to_best  -23.4581  9.09814  4.18481  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -23.4581  9.09814  4.18481  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.4581  9.09814  4.18481  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.8354  9.09814  4.18481  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.9965  9.09814  4.18481  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.8022  9.09814  4.18481  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.2422  9.10433  4.23235  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2422  9.10433  4.23235  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.6994  9.10433  4.23235  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 622 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.8733  9.10433  4.23235  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.0085  9.10433  4.23235  0.154
protocols.relax.FastRelax: {0} CMD: min  -35.6293  9.10176  4.20426  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.6293  9.10176  4.20426  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.6348  9.10176  4.20426  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.6348  9.10176  4.20426  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.0832  9.10176  4.20426  0.31955
protocols.relax.FastRelax: {0} CMD: min  -28.4691  9.0884  4.18339  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.4691  9.0884  4.18339  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.6977  9.0884  4.18339  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.7149  9.0884  4.18339  0.55
protocols.relax.FastRelax: {0} CMD: min  -23.4585  9.10253  4.19346  0.55
protocols.relax.FastRelax: {0} MRP: 3  -23.4585  -23.4585  9.10253  4.19346
protocols.relax.FastRelax: {0} CMD: accept_to_best  -23.4585  9.10253  4.19346  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -23.4585  9.10253  4.19346  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.4585  9.10253  4.19346  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.8406  9.10253  4.19346  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.0067  9.10253  4.19346  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.8134  9.10253  4.19346  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.5551  9.15293  4.31737  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.5551  9.15293  4.31737  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4581  9.15293  4.31737  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 623 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.7358  9.15293  4.31737  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5586  9.15293  4.31737  0.154
protocols.relax.FastRelax: {0} CMD: min  -35.2989  9.11845  4.25318  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.2989  9.11845  4.25318  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.3696  9.11845  4.25318  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.3702  9.11845  4.25318  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.8239  9.11845  4.25318  0.31955
protocols.relax.FastRelax: {0} CMD: min  -28.5723  9.10124  4.21509  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.5723  9.10124  4.21509  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.1961  9.10124  4.21509  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.2175  9.10124  4.21509  0.55
protocols.relax.FastRelax: {0} CMD: min  -23.4584  9.10351  4.19637  0.55
protocols.relax.FastRelax: {0} MRP: 4  -23.4584  -23.4585  9.10253  4.19346
protocols.relax.FastRelax: {0} CMD: accept_to_best  -23.4584  9.10351  4.19637  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -23.4584  9.10351  4.19637  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_35.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13539.9  9.62623  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13539.9  9.62623  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1863.39  9.62623  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 599 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  81.8249  9.62623  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  83.4944  9.62623  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -13.8993  9.3949  2.38019  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.8993  9.3949  2.38019  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.88003  9.3949  2.38019  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 616 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.600046  9.3949  2.38019  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  0.504724  9.3949  2.38019  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.4606  9.58742  2.78825  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.4606  9.58742  2.78825  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.56086  9.58742  2.78825  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 628 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.75458  9.58742  2.78825  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.21358  9.58742  2.78825  0.31955
protocols.relax.FastRelax: {0} CMD: min  -8.78135  9.60112  2.77191  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.78135  9.60112  2.77191  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  0.338691  9.60112  2.77191  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.00120395  9.60112  2.77191  0.55
protocols.relax.FastRelax: {0} CMD: min  118.812  11.068  7.16488  0.55
protocols.relax.FastRelax: {0} MRP: 0  118.812  118.812  11.068  7.16488
protocols.relax.FastRelax: {0} CMD: accept_to_best  118.812  11.068  7.16488  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  118.812  11.068  7.16488  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  118.812  11.068  7.16488  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.7613  11.068  7.16488  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 667 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -46.6155  11.068  7.16488  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.0274  11.068  7.16488  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.6134  10.8985  6.88511  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.6134  10.8985  6.88511  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.3302  10.8985  6.88511  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 652 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.6383  10.8985  6.88511  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.9185  10.8985  6.88511  0.154
protocols.relax.FastRelax: {0} CMD: min  -44.8688  10.8927  6.87752  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.8688  10.8927  6.87752  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.7906  10.8927  6.87752  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.8073  10.8927  6.87752  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.3294  10.8927  6.87752  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.8022  10.9023  6.89404  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.8022  10.9023  6.89404  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.8442  10.9023  6.89404  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.8445  10.9023  6.89404  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.4938  10.5751  6.27734  0.55
protocols.relax.FastRelax: {0} MRP: 1  -35.4938  -35.4938  10.5751  6.27734
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.4938  10.5751  6.27734  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.4938  10.5751  6.27734  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.4938  10.5751  6.27734  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.3234  10.5751  6.27734  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.3894  10.5751  6.27734  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.8791  10.5751  6.27734  0.02805
protocols.relax.FastRelax: {0} CMD: min  -53.1098  10.5658  6.08209  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -53.1098  10.5658  6.08209  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.8092  10.5658  6.08209  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.1751  10.5658  6.08209  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.2353  10.5658  6.08209  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.4259  10.5238  6.19911  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.4259  10.5238  6.19911  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.72  10.5238  6.19911  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 649 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.7353  10.5238  6.19911  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.2858  10.5238  6.19911  0.31955
protocols.relax.FastRelax: {0} CMD: min  -41.0872  10.5498  6.19021  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.0872  10.5498  6.19021  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.6919  10.5498  6.19021  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.6928  10.5498  6.19021  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.5593  10.5674  6.30016  0.55
protocols.relax.FastRelax: {0} MRP: 2  -35.5593  -35.5593  10.5674  6.30016
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.5593  10.5674  6.30016  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.5593  10.5674  6.30016  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.5593  10.5674  6.30016  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.3606  10.5674  6.30016  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.2222  10.5674  6.30016  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.6704  10.5674  6.30016  0.02805
protocols.relax.FastRelax: {0} CMD: min  -53.7502  10.5492  6.09374  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -53.7502  10.5492  6.09374  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.7673  10.5492  6.09374  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.8217  10.5492  6.09374  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.1717  10.5492  6.09374  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.3106  10.5543  6.21328  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.3106  10.5543  6.21328  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.1907  10.5543  6.21328  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.1962  10.5543  6.21328  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.7143  10.5543  6.21328  0.31955
protocols.relax.FastRelax: {0} CMD: min  -41.1332  10.5497  6.28148  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.1332  10.5497  6.28148  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.8313  10.5497  6.28148  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.8317  10.5497  6.28148  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.5595  10.5745  6.31911  0.55
protocols.relax.FastRelax: {0} MRP: 3  -35.5595  -35.5595  10.5745  6.31911
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.5595  10.5745  6.31911  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.5595  10.5745  6.31911  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.5595  10.5745  6.31911  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.3625  10.5745  6.31911  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.2164  10.5745  6.31911  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.6595  10.5745  6.31911  0.02805
protocols.relax.FastRelax: {0} CMD: min  -53.0499  10.5901  6.12785  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -53.0499  10.5901  6.12785  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.8501  10.5901  6.12785  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.2823  10.5901  6.12785  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.697  10.5901  6.12785  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.2057  10.5455  6.17304  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.2057  10.5455  6.17304  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.1338  10.5455  6.17304  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.3061  10.5455  6.17304  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.8283  10.5455  6.17304  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.7427  10.5606  6.22291  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.7427  10.5606  6.22291  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.8657  10.5606  6.22291  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.8662  10.5606  6.22291  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.5602  10.5632  6.28665  0.55
protocols.relax.FastRelax: {0} MRP: 4  -35.5602  -35.5602  10.5632  6.28665
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.5602  10.5632  6.28665  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.5602  10.5632  6.28665  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_45.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13918.5  8.11928  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13918.5  8.11928  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2127.69  8.11928  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  151.343  8.11928  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  178.064  8.11928  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -18.1638  8.98494  4.95238  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.1638  8.98494  4.95238  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.81586  8.98494  4.95238  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.46432  8.98494  4.95238  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.369188  8.98494  4.95238  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.7821  9.77683  6.59077  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.7821  9.77683  6.59077  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.65762  9.77683  6.59077  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -7.77226  9.77683  6.59077  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.13821  9.77683  6.59077  0.31955
protocols.relax.FastRelax: {0} CMD: min  -9.52475  9.73084  6.44924  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.52475  9.73084  6.44924  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.07082  9.73084  6.44924  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.07581  9.73084  6.44924  0.55
protocols.relax.FastRelax: {0} CMD: min  -7.09474  9.75492  6.28819  0.55
protocols.relax.FastRelax: {0} MRP: 0  -7.09474  -7.09474  9.75492  6.28819
protocols.relax.FastRelax: {0} CMD: accept_to_best  -7.09474  9.75492  6.28819  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -7.09474  9.75492  6.28819  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -7.09474  9.75492  6.28819  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.1693  9.75492  6.28819  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 685 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8904  9.75492  6.28819  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.0102  9.75492  6.28819  0.02805
protocols.relax.FastRelax: {0} CMD: min  -28.024  9.77826  6.41136  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.024  9.77826  6.41136  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.79459  9.77826  6.41136  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.9354  9.77826  6.41136  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.9622  9.77826  6.41136  0.154
protocols.relax.FastRelax: {0} CMD: min  -18.7397  9.7586  6.46734  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.7397  9.7586  6.46734  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.1207  9.7586  6.46734  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.1386  9.7586  6.46734  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.6185  9.7586  6.46734  0.31955
protocols.relax.FastRelax: {0} CMD: min  -13.8081  9.7665  6.49043  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.8081  9.7665  6.49043  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.83243  9.7665  6.49043  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.5101  9.7665  6.49043  0.55
protocols.relax.FastRelax: {0} CMD: min  -8.82718  9.90014  6.7098  0.55
protocols.relax.FastRelax: {0} MRP: 1  -8.82718  -8.82718  9.90014  6.7098
protocols.relax.FastRelax: {0} CMD: accept_to_best  -8.82718  9.90014  6.7098  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -8.82718  9.90014  6.7098  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.82718  9.90014  6.7098  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.4831  9.90014  6.7098  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 697 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.1701  9.90014  6.7098  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.9853  9.90014  6.7098  0.02805
protocols.relax.FastRelax: {0} CMD: min  -21.1267  9.89559  6.70774  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.1267  9.89559  6.70774  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.4955  9.89559  6.70774  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.979  9.89559  6.70774  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.7869  9.89559  6.70774  0.154
protocols.relax.FastRelax: {0} CMD: min  -17.8512  9.89224  6.70618  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.8512  9.89224  6.70618  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.2485  9.89224  6.70618  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 628 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.2485  9.89224  6.70618  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.9644  9.89224  6.70618  0.31955
protocols.relax.FastRelax: {0} CMD: min  -13.98  9.8904  6.70512  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.98  9.8904  6.70512  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.5558  9.8904  6.70512  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.55582  9.8904  6.70512  0.55
protocols.relax.FastRelax: {0} CMD: min  -9.3841  9.87993  6.71012  0.55
protocols.relax.FastRelax: {0} MRP: 2  -9.3841  -9.3841  9.87993  6.71012
protocols.relax.FastRelax: {0} CMD: accept_to_best  -9.3841  9.87993  6.71012  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -9.3841  9.87993  6.71012  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.3841  9.87993  6.71012  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.2042  9.87993  6.71012  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 704 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.8469  9.87993  6.71012  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.9379  9.87993  6.71012  0.02805
protocols.relax.FastRelax: {0} CMD: min  -21.0722  9.87638  6.7085  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.0722  9.87638  6.7085  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.34878  9.87638  6.7085  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.5956  9.87638  6.7085  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.401  9.87638  6.7085  0.154
protocols.relax.FastRelax: {0} CMD: min  -18.4629  9.87398  6.70746  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.4629  9.87398  6.70746  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.8129  9.87398  6.70746  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.8129  9.87398  6.70746  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.5251  9.87398  6.70746  0.31955
protocols.relax.FastRelax: {0} CMD: min  -14.5355  9.87332  6.70723  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.5355  9.87332  6.70723  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.03567  9.87332  6.70723  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 624 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.03571  9.87332  6.70723  0.55
protocols.relax.FastRelax: {0} CMD: min  -9.38267  9.88602  6.72081  0.55
protocols.relax.FastRelax: {0} MRP: 3  -9.38267  -9.3841  9.87993  6.71012
protocols.relax.FastRelax: {0} CMD: accept_to_best  -9.38267  9.88602  6.72081  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -9.38267  9.88602  6.72081  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.38267  9.88602  6.72081  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.2015  9.88602  6.72081  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.8608  9.88602  6.72081  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.6737  9.88602  6.72081  0.02805
protocols.relax.FastRelax: {0} CMD: min  -21.8117  9.88217  6.71897  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.8117  9.88217  6.71897  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.1373  9.88217  6.71897  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.6067  9.88217  6.71897  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.4122  9.88217  6.71897  0.154
protocols.relax.FastRelax: {0} CMD: min  -18.474  9.87983  6.71796  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.474  9.87983  6.71796  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.8262  9.87983  6.71796  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.8262  9.87983  6.71796  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.5385  9.87983  6.71796  0.31955
protocols.relax.FastRelax: {0} CMD: min  -14.5489  9.87923  6.71778  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.5489  9.87923  6.71778  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.05251  9.87923  6.71778  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 624 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.05255  9.87923  6.71778  0.55
protocols.relax.FastRelax: {0} CMD: min  -9.38289  9.88921  6.72529  0.55
protocols.relax.FastRelax: {0} MRP: 4  -9.38289  -9.3841  9.87993  6.71012
protocols.relax.FastRelax: {0} CMD: accept_to_best  -9.38289  9.88921  6.72529  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -9.38289  9.88921  6.72529  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_23.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14018.3  8.56048  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14018.3  8.56048  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1905.06  8.56048  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 578 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  82.2227  8.56048  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  85.6858  8.56048  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  52.6155  8.86319  2.62931  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  52.6155  8.86319  2.62931  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  103.461  8.86319  2.62931  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 568 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  64.9831  8.86319  2.62931  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  66.2384  8.86319  2.62931  0.154
protocols.relax.FastRelax: {0} CMD: min  -13.5058  8.34284  3.7602  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.5058  8.34284  3.7602  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.01322  8.34284  3.7602  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 607 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -6.94757  8.34284  3.7602  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.34746  8.34284  3.7602  0.31955
protocols.relax.FastRelax: {0} CMD: min  -6.62202  8.32968  3.74547  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -6.62202  8.32968  3.74547  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.23025  8.32968  3.74547  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 601 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  3.97188  8.32968  3.74547  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.4292  8.66524  4.76921  0.55
protocols.relax.FastRelax: {0} MRP: 0  -10.4292  -10.4292  8.66524  4.76921
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.4292  8.66524  4.76921  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.4292  8.66524  4.76921  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.4292  8.66524  4.76921  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.9525  8.66524  4.76921  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.2601  8.66524  4.76921  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0739  8.66524  4.76921  0.02805
protocols.relax.FastRelax: {0} CMD: min  -25.9461  8.70747  4.83746  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.9461  8.70747  4.83746  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7368  8.70747  4.83746  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 640 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.1466  8.70747  4.83746  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.8199  8.70747  4.83746  0.154
protocols.relax.FastRelax: {0} CMD: min  -21.4711  8.68111  4.7979  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.4711  8.68111  4.7979  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7912  8.68111  4.7979  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7913  8.68111  4.7979  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.4222  8.68111  4.7979  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.592  8.67098  4.78396  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.592  8.67098  4.78396  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.1073  8.67098  4.78396  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.1073  8.67098  4.78396  0.55
protocols.relax.FastRelax: {0} CMD: min  -13.4756  8.39315  5.01646  0.55
protocols.relax.FastRelax: {0} MRP: 1  -13.4756  -13.4756  8.39315  5.01646
protocols.relax.FastRelax: {0} CMD: accept_to_best  -13.4756  8.39315  5.01646  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -13.4756  8.39315  5.01646  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.4756  8.39315  5.01646  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.1733  8.39315  5.01646  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.2591  8.39315  5.01646  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.0997  8.39315  5.01646  0.02805
protocols.relax.FastRelax: {0} CMD: min  -28.6752  8.43734  5.06771  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.6752  8.43734  5.06771  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.4156  8.43734  5.06771  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.4156  8.43734  5.06771  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.117  8.43734  5.06771  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.5508  8.41957  5.04322  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.5508  8.41957  5.04322  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.8155  8.41957  5.04322  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 628 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8155  8.41957  5.04322  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4421  8.41957  5.04322  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.6718  8.40538  5.02619  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.6718  8.40538  5.02619  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.1565  8.40538  5.02619  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 618 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.1565  8.40538  5.02619  0.55
protocols.relax.FastRelax: {0} CMD: min  -13.5002  8.39752  5.1232  0.55
protocols.relax.FastRelax: {0} MRP: 2  -13.5002  -13.5002  8.39752  5.1232
protocols.relax.FastRelax: {0} CMD: accept_to_best  -13.5002  8.39752  5.1232  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -13.5002  8.39752  5.1232  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.5002  8.39752  5.1232  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.1097  8.39752  5.1232  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1885  8.39752  5.1232  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.0304  8.39752  5.1232  0.02805
protocols.relax.FastRelax: {0} CMD: min  -28.5722  8.4464  5.17846  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.5722  8.4464  5.17846  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3264  8.4464  5.17846  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.3264  8.4464  5.17846  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0288  8.4464  5.17846  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.4877  8.42614  5.15065  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.4877  8.42614  5.15065  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.7972  8.42614  5.15065  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.7972  8.42614  5.15065  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4274  8.42614  5.15065  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.6555  8.41089  5.13303  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.6555  8.41089  5.13303  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.2004  8.41089  5.13303  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 619 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.2005  8.41089  5.13303  0.55
protocols.relax.FastRelax: {0} CMD: min  -13.5054  8.39939  5.12699  0.55
protocols.relax.FastRelax: {0} MRP: 3  -13.5054  -13.5054  8.39939  5.12699
protocols.relax.FastRelax: {0} CMD: accept_to_best  -13.5054  8.39939  5.12699  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -13.5054  8.39939  5.12699  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.5054  8.39939  5.12699  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.1086  8.39939  5.12699  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1894  8.39939  5.12699  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.0281  8.39939  5.12699  0.02805
protocols.relax.FastRelax: {0} CMD: min  -28.5493  8.44868  5.18428  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.5493  8.44868  5.18428  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.2382  8.44868  5.18428  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.2382  8.44868  5.18428  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.936  8.44868  5.18428  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.4038  8.42768  5.15528  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.4038  8.42768  5.15528  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.6342  8.42768  5.15528  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.6342  8.42768  5.15528  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.2581  8.42768  5.15528  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.4902  8.41211  5.13752  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.4902  8.41211  5.13752  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.9214  8.41211  5.13752  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 619 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.9214  8.41211  5.13752  0.55
protocols.relax.FastRelax: {0} CMD: min  -13.5194  8.42818  5.15742  0.55
protocols.relax.FastRelax: {0} MRP: 4  -13.5194  -13.5194  8.42818  5.15742
protocols.relax.FastRelax: {0} CMD: accept_to_best  -13.5194  8.42818  5.15742  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -13.5194  8.42818  5.15742  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_21.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13694.2  7.86898  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13694.2  7.86898  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1845.27  7.86898  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  43.958  7.86898  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  45.9725  7.86898  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -23.9542  7.8224  7.42572  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.9542  7.8224  7.42572  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.32111  7.8224  7.42572  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.3498  7.8224  7.42572  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.414  7.8224  7.42572  0.154
protocols.relax.FastRelax: {0} CMD: min  -10.4968  7.82524  7.42583  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.4968  7.82524  7.42583  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6.81584  7.82524  7.42583  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  6.25147  7.82524  7.42583  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7.50286  7.82524  7.42583  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.2076  7.9851  8.31851  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.2076  7.9851  8.31851  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.43894  7.9851  8.31851  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 622 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.43897  7.9851  8.31851  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.6888  8.29313  9.6511  0.55
protocols.relax.FastRelax: {0} MRP: 0  -16.6888  -16.6888  8.29313  9.6511
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.6888  8.29313  9.6511  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.6888  8.29313  9.6511  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6888  8.29313  9.6511  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.1285  8.29313  9.6511  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 660 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.995  8.29313  9.6511  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.7848  8.29313  9.6511  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.798  8.29207  9.65109  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.798  8.29207  9.65109  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.7051  8.29207  9.65109  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.3104  8.29207  9.65109  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.074  8.29207  9.65109  0.154
protocols.relax.FastRelax: {0} CMD: min  -29.0823  8.29123  9.65096  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.0823  8.29123  9.65096  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.6821  8.29123  9.65096  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 613 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.6821  8.29123  9.65096  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3351  8.29123  9.65096  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.3381  8.29078  9.65092  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.3381  8.29078  9.65092  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.7273  8.29078  9.65092  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 611 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.6825  8.29078  9.65092  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.2891  8.4393  9.93  0.55
protocols.relax.FastRelax: {0} MRP: 1  -19.2891  -19.2891  8.4393  9.93
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.2891  8.4393  9.93  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.2891  8.4393  9.93  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.2891  8.4393  9.93  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.7729  8.4393  9.93  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.3071  8.4393  9.93  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.1063  8.4393  9.93  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.1199  8.43831  9.93001  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.1199  8.43831  9.93001  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2101  8.43831  9.93001  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.5491  8.43831  9.93001  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.3152  8.43831  9.93001  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.3228  8.4375  9.92989  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3228  8.4375  9.92989  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9697  8.4375  9.92989  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9697  8.4375  9.92989  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.6265  8.4375  9.92989  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.6287  8.43706  9.9298  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.6287  8.43706  9.9298  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.0889  8.43706  9.9298  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.0889  8.43706  9.9298  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.2912  8.44051  9.93445  0.55
protocols.relax.FastRelax: {0} MRP: 2  -19.2912  -19.2912  8.44051  9.93445
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.2912  8.44051  9.93445  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.2912  8.44051  9.93445  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.2912  8.44051  9.93445  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.7635  8.44051  9.93445  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.3136  8.44051  9.93445  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.1114  8.44051  9.93445  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.125  8.43952  9.93447  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.125  8.43952  9.93447  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1888  8.43952  9.93447  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.5416  8.43952  9.93447  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.308  8.43952  9.93447  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.3156  8.43872  9.93434  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3156  8.43872  9.93434  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9668  8.43872  9.93434  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9668  8.43872  9.93434  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.6239  8.43872  9.93434  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.6262  8.43828  9.93425  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.6262  8.43828  9.93425  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.0928  8.43828  9.93425  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 609 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.0928  8.43828  9.93425  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.2915  8.43932  9.93343  0.55
protocols.relax.FastRelax: {0} MRP: 3  -19.2915  -19.2915  8.43932  9.93343
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.2915  8.43932  9.93343  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.2915  8.43932  9.93343  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.2915  8.43932  9.93343  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.7693  8.43932  9.93343  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.3154  8.43932  9.93343  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.1139  8.43932  9.93343  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.1275  8.43833  9.93346  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.1275  8.43833  9.93346  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.2034  8.43833  9.93346  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.5441  8.43833  9.93346  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.3105  8.43833  9.93346  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.3181  8.43754  9.93334  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3181  8.43754  9.93334  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9687  8.43754  9.93334  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9687  8.43754  9.93334  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.6258  8.43754  9.93334  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.628  8.4371  9.93325  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.628  8.4371  9.93325  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.0937  8.4371  9.93325  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.0937  8.4371  9.93325  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.2917  8.43976  9.93251  0.55
protocols.relax.FastRelax: {0} MRP: 4  -19.2917  -19.2917  8.43976  9.93251
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.2917  8.43976  9.93251  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.2917  8.43976  9.93251  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_10.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16894.3  5.5865  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16894.3  5.5865  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2266.27  5.5865  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  199.111  5.5865  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  241.355  5.5865  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  78.2382  15.2826  16.1363  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  78.2382  15.2826  16.1363  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  121.729  15.2826  16.1363  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  91.2131  15.2826  16.1363  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  92.9818  15.2826  16.1363  0.154
protocols.relax.FastRelax: {0} CMD: min  -19.0217  11.7383  12.2778  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.0217  11.7383  12.2778  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.4563  11.7383  12.2778  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.9892  11.7383  12.2778  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.479  11.7383  12.2778  0.31955
protocols.relax.FastRelax: {0} CMD: min  -13.5342  11.743  12.2836  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.5342  11.743  12.2836  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.88236  11.743  12.2836  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -3.88237  11.743  12.2836  0.55
protocols.relax.FastRelax: {0} CMD: min  -18.9195  13.4113  13.6826  0.55
protocols.relax.FastRelax: {0} MRP: 0  -18.9195  -18.9195  13.4113  13.6826
protocols.relax.FastRelax: {0} CMD: accept_to_best  -18.9195  13.4113  13.6826  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -18.9195  13.4113  13.6826  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.9195  13.4113  13.6826  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.9553  13.4113  13.6826  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.1691  13.4113  13.6826  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.0023  13.4113  13.6826  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.0177  13.4081  13.6791  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.0177  13.4081  13.6791  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.7688  13.4081  13.6791  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.7995  13.4081  13.6791  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.5746  13.4081  13.6791  0.154
protocols.relax.FastRelax: {0} CMD: min  -28.5834  13.4067  13.6774  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.5834  13.4067  13.6774  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3976  13.4067  13.6774  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.6045  13.4067  13.6774  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3228  13.4067  13.6774  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.3279  13.4065  13.6771  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.3279  13.4065  13.6771  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.9628  13.4065  13.6771  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.9629  13.4065  13.6771  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2692  13.5739  13.8921  0.55
protocols.relax.FastRelax: {0} MRP: 1  -21.2692  -21.2692  13.5739  13.8921
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2692  13.5739  13.8921  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2692  13.5739  13.8921  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2692  13.5739  13.8921  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.5684  13.5739  13.8921  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.7274  13.5739  13.8921  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4584  13.5739  13.8921  0.02805
protocols.relax.FastRelax: {0} CMD: min  -33.4758  13.5708  13.8885  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4758  13.5708  13.8885  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2469  13.5708  13.8885  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.8339  13.5708  13.8885  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.6061  13.5708  13.8885  0.154
protocols.relax.FastRelax: {0} CMD: min  -29.6147  13.5693  13.8867  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.6147  13.5693  13.8867  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3757  13.5693  13.8867  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.574  13.5693  13.8867  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2879  13.5693  13.8867  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.293  13.569  13.8864  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.293  13.569  13.8864  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.8445  13.569  13.8864  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8445  13.569  13.8864  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2622  13.5817  13.8998  0.55
protocols.relax.FastRelax: {0} MRP: 2  -21.2622  -21.2692  13.5739  13.8921
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2622  13.5817  13.8998  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2622  13.5817  13.8998  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2622  13.5817  13.8998  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.5243  13.5817  13.8998  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.671  13.5817  13.8998  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4045  13.5817  13.8998  0.02805
protocols.relax.FastRelax: {0} CMD: min  -33.4218  13.5786  13.8962  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4218  13.5786  13.8962  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2405  13.5786  13.8962  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.8122  13.5786  13.8962  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.5852  13.5786  13.8962  0.154
protocols.relax.FastRelax: {0} CMD: min  -29.5938  13.577  13.8944  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.5938  13.577  13.8944  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3682  13.577  13.8944  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.577  13.577  13.8944  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2922  13.577  13.8944  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.2972  13.5767  13.894  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.2972  13.5767  13.894  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.8725  13.5767  13.894  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 667 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8725  13.5767  13.894  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2653  13.5864  13.9055  0.55
protocols.relax.FastRelax: {0} MRP: 3  -21.2653  -21.2692  13.5739  13.8921
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2653  13.5864  13.9055  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2653  13.5864  13.9055  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2653  13.5864  13.9055  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.5528  13.5864  13.9055  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.6983  13.5864  13.9055  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4289  13.5864  13.9055  0.02805
protocols.relax.FastRelax: {0} CMD: min  -33.4464  13.5832  13.9019  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4464  13.5832  13.9019  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2106  13.5832  13.9019  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.8302  13.5832  13.9019  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.603  13.5832  13.9019  0.154
protocols.relax.FastRelax: {0} CMD: min  -29.6117  13.5817  13.9001  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.6117  13.5817  13.9001  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3837  13.5817  13.9001  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.5723  13.5817  13.9001  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.287  13.5817  13.9001  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.292  13.5813  13.8996  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.292  13.5813  13.8996  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.8572  13.5813  13.8996  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 667 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8572  13.5813  13.8996  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.2652  13.5857  13.9048  0.55
protocols.relax.FastRelax: {0} MRP: 4  -21.2652  -21.2692  13.5739  13.8921
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.2652  13.5857  13.9048  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.2652  13.5857  13.9048  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_18.pdb
protocols.relax.FastRelax: {0} CMD: repeat  17833.1  7.82024  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  17833.1  7.82024  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1902.09  7.82024  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  144.74  7.82024  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  175.508  7.82024  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -16.6469  8.61471  5.08345  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6469  8.61471  5.08345  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7.3725  8.61471  5.08345  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  0.978489  8.61471  5.08345  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.34424  8.61471  5.08345  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.2415  9.12336  4.62706  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.2415  9.12336  4.62706  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.0438  9.12336  4.62706  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.1461  9.12336  4.62706  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.3441  9.12336  4.62706  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.7682  9.09257  4.58815  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.7682  9.09257  4.58815  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.38368  9.09257  4.58815  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.47037  9.09257  4.58815  0.55
protocols.relax.FastRelax: {0} CMD: min  -15.7696  9.51572  4.70689  0.55
protocols.relax.FastRelax: {0} MRP: 0  -15.7696  -15.7696  9.51572  4.70689
protocols.relax.FastRelax: {0} CMD: accept_to_best  -15.7696  9.51572  4.70689  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -15.7696  9.51572  4.70689  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.7696  9.51572  4.70689  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.5918  9.51572  4.70689  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.759  9.51572  4.70689  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1737  9.51572  4.70689  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.2356  9.31895  4.56762  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.2356  9.31895  4.56762  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.8165  9.31895  4.56762  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.263  9.31895  4.56762  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.6988  9.31895  4.56762  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.0656  9.38597  4.59632  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.0656  9.38597  4.59632  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.007  9.38597  4.59632  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.1952  9.38597  4.59632  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.4917  9.38597  4.59632  0.31955
protocols.relax.FastRelax: {0} CMD: min  -23.3243  9.36452  4.57033  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.3243  9.36452  4.57033  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.562  9.36452  4.57033  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.625  9.36452  4.57033  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6857  9.5085  4.59243  0.55
protocols.relax.FastRelax: {0} MRP: 1  -17.6857  -17.6857  9.5085  4.59243
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6857  9.5085  4.59243  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6857  9.5085  4.59243  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6857  9.5085  4.59243  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5707  9.5085  4.59243  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.6177  9.5085  4.59243  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.4204  9.5085  4.59243  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.6169  9.42635  4.56995  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.6169  9.42635  4.56995  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0316  9.42635  4.56995  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.095  9.42635  4.56995  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.7977  9.42635  4.56995  0.154
protocols.relax.FastRelax: {0} CMD: min  -33.3841  9.39565  4.54283  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.3841  9.39565  4.54283  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.9279  9.39565  4.54283  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.9361  9.39565  4.54283  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.2693  9.39565  4.54283  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.8643  9.36656  4.50247  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.8643  9.36656  4.50247  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.4266  9.36656  4.50247  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.4779  9.36656  4.50247  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6754  9.503  4.58916  0.55
protocols.relax.FastRelax: {0} MRP: 2  -17.6754  -17.6857  9.5085  4.59243
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6754  9.503  4.58916  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6754  9.503  4.58916  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6754  9.503  4.58916  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5585  9.503  4.58916  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.611  9.503  4.58916  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.4138  9.503  4.58916  0.02805
protocols.relax.FastRelax: {0} CMD: min  -41.1786  9.58898  4.7144  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.1786  9.58898  4.7144  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.0824  9.58898  4.7144  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.1378  9.58898  4.7144  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.8735  9.58898  4.7144  0.154
protocols.relax.FastRelax: {0} CMD: min  -33.092  9.45422  4.57562  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.092  9.45422  4.57562  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2781  9.45422  4.57562  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 640 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.2781  9.45422  4.57562  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.6619  9.45422  4.57562  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.1398  9.4291  4.54135  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.1398  9.4291  4.54135  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4186  9.4291  4.54135  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.4231  9.4291  4.54135  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6925  9.50904  4.59644  0.55
protocols.relax.FastRelax: {0} MRP: 3  -17.6925  -17.6925  9.50904  4.59644
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6925  9.50904  4.59644  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6925  9.50904  4.59644  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6925  9.50904  4.59644  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5262  9.50904  4.59644  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5673  9.50904  4.59644  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.3707  9.50904  4.59644  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.4099  9.20639  4.41628  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.4099  9.20639  4.41628  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.889  9.20639  4.41628  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 673 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.0961  9.20639  4.41628  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.6132  9.20639  4.41628  0.154
protocols.relax.FastRelax: {0} CMD: min  -33.333  9.36888  4.5142  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.333  9.36888  4.5142  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.7334  9.36888  4.5142  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.7449  9.36888  4.5142  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.9879  9.36888  4.5142  0.31955
protocols.relax.FastRelax: {0} CMD: min  -23.6389  9.33452  4.46748  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.6389  9.33452  4.46748  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.5878  9.33452  4.46748  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.613  9.33452  4.46748  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6848  9.50617  4.5981  0.55
protocols.relax.FastRelax: {0} MRP: 4  -17.6848  -17.6925  9.50904  4.59644
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6848  9.50617  4.5981  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6848  9.50617  4.5981  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_6.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15996.5  9.08306  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15996.5  9.08306  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1945.91  9.08306  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  89.2574  9.08306  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  101.045  9.08306  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -25.7305  8.34076  3.4874  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7305  8.34076  3.4874  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.92024  8.34076  3.4874  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.9663  8.34076  3.4874  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.9441  8.34076  3.4874  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.1132  8.29649  3.54555  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.1132  8.29649  3.54555  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.2517  8.29649  3.54555  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.5353  8.29649  3.54555  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.0091  8.29649  3.54555  0.31955
protocols.relax.FastRelax: {0} CMD: min  -23.1774  8.27393  3.55134  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.1774  8.27393  3.55134  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.6734  8.27393  3.55134  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.8386  8.27393  3.55134  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.4461  7.84773  4.13101  0.55
protocols.relax.FastRelax: {0} MRP: 0  -26.4461  -26.4461  7.84773  4.13101
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.4461  7.84773  4.13101  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.4461  7.84773  4.13101  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.4461  7.84773  4.13101  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.5695  7.84773  4.13101  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 730 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.4929  7.84773  4.13101  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.2936  7.84773  4.13101  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.1215  7.84088  4.17594  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.1215  7.84088  4.17594  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.9744  7.84088  4.17594  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.1763  7.84088  4.17594  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.852  7.84088  4.17594  0.154
protocols.relax.FastRelax: {0} CMD: min  -38.3335  7.86339  4.09729  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.3335  7.86339  4.09729  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.2432  7.86339  4.09729  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 681 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.258  7.86339  4.09729  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.8568  7.86339  4.09729  0.31955
protocols.relax.FastRelax: {0} CMD: min  -32.9687  7.86201  4.07933  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.9687  7.86201  4.07933  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.574  7.86201  4.07933  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 674 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.574  7.86201  4.07933  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.2592  7.81359  4.00145  0.55
protocols.relax.FastRelax: {0} MRP: 1  -28.2592  -28.2592  7.81359  4.00145
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.2592  7.81359  4.00145  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.2592  7.81359  4.00145  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.2592  7.81359  4.00145  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.2758  7.81359  4.00145  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.7512  7.81359  4.00145  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.5762  7.81359  4.00145  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.5633  7.81204  4.04698  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.5633  7.81204  4.04698  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.8443  7.81204  4.04698  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 694 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.8619  7.81204  4.04698  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.5364  7.81204  4.04698  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.8434  7.84759  3.94193  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.8434  7.84759  3.94193  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5209  7.84759  3.94193  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.527  7.84759  3.94193  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.1084  7.84759  3.94193  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.2115  7.8313  3.94297  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.2115  7.8313  3.94297  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.6727  7.8313  3.94297  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.6792  7.8313  3.94297  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.2609  7.8094  3.99007  0.55
protocols.relax.FastRelax: {0} MRP: 2  -28.2609  -28.2609  7.8094  3.99007
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.2609  7.8094  3.99007  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.2609  7.8094  3.99007  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.2609  7.8094  3.99007  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.2641  7.8094  3.99007  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.747  7.8094  3.99007  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.5725  7.8094  3.99007  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.5504  7.79759  4.04881  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.5504  7.79759  4.04881  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.7005  7.79759  4.04881  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 694 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.755  7.79759  4.04881  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.421  7.79759  4.04881  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.1284  7.83335  3.99388  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.1284  7.83335  3.99388  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.7303  7.83335  3.99388  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 669 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.7303  7.83335  3.99388  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.3046  7.83335  3.99388  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.1225  7.8344  3.95332  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.1225  7.8344  3.95332  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.326  7.8344  3.95332  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 657 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.3261  7.8344  3.95332  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.2685  7.80349  3.97957  0.55
protocols.relax.FastRelax: {0} MRP: 3  -28.2685  -28.2685  7.80349  3.97957
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.2685  7.80349  3.97957  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.2685  7.80349  3.97957  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.2685  7.80349  3.97957  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.2539  7.80349  3.97957  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 705 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.7457  7.80349  3.97957  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.5712  7.80349  3.97957  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.4174  7.77185  4.06856  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.4174  7.77185  4.06856  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.4377  7.77185  4.06856  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 693 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.585  7.77185  4.06856  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.2456  7.77185  4.06856  0.154
protocols.relax.FastRelax: {0} CMD: min  -38.8891  7.82021  3.97664  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.8891  7.82021  3.97664  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.5796  7.82021  3.97664  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.5796  7.82021  3.97664  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1609  7.82021  3.97664  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.8841  7.81615  3.96932  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.8841  7.81615  3.96932  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.8161  7.81615  3.96932  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.8167  7.81615  3.96932  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.2311  7.82297  3.9727  0.55
protocols.relax.FastRelax: {0} MRP: 4  -28.2311  -28.2685  7.80349  3.97957
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.2311  7.82297  3.9727  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.2311  7.82297  3.9727  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_27.pdb
protocols.relax.FastRelax: {0} CMD: repeat  18966.5  6.50103  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  18966.5  6.50103  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2102.4  6.50103  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 543 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  53.0542  6.50103  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  56.5316  6.50103  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -40.8983  8.27865  6.17198  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.8983  8.27865  6.17198  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.85711  8.27865  6.17198  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 752 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.6636  8.27865  6.17198  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.0434  8.27865  6.17198  0.154
protocols.relax.FastRelax: {0} CMD: min  -41.7067  8.69942  7.00564  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.7067  8.69942  7.00564  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.7175  8.69942  7.00564  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 703 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.8326  8.69942  7.00564  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.1258  8.69942  7.00564  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.2255  8.75749  7.04603  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.2255  8.75749  7.04603  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.0993  8.75749  7.04603  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.2419  8.75749  7.04603  0.55
protocols.relax.FastRelax: {0} CMD: min  -45.2589  8.98207  7.68865  0.55
protocols.relax.FastRelax: {0} MRP: 0  -45.2589  -45.2589  8.98207  7.68865
protocols.relax.FastRelax: {0} CMD: accept_to_best  -45.2589  8.98207  7.68865  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -45.2589  8.98207  7.68865  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.2589  8.98207  7.68865  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -60.4809  8.98207  7.68865  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -65.8128  8.98207  7.68865  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -65.6064  8.98207  7.68865  0.02805
protocols.relax.FastRelax: {0} CMD: min  -67.9759  9.12051  7.87602  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -67.9759  9.12051  7.87602  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -61.0934  9.12051  7.87602  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -61.3354  9.12051  7.87602  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -60.8702  9.12051  7.87602  0.154
protocols.relax.FastRelax: {0} CMD: min  -63.2621  8.97982  7.76104  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -63.2621  8.97982  7.76104  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -55.9327  8.97982  7.76104  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -55.9504  8.97982  7.76104  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -55.3739  8.97982  7.76104  0.31955
protocols.relax.FastRelax: {0} CMD: min  -57.1332  8.97378  7.709  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -57.1332  8.97378  7.709  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.6276  8.97378  7.709  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 674 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.6503  8.97378  7.709  0.55
protocols.relax.FastRelax: {0} CMD: min  -52.7393  8.83739  7.46887  0.55
protocols.relax.FastRelax: {0} MRP: 1  -52.7393  -52.7393  8.83739  7.46887
protocols.relax.FastRelax: {0} CMD: accept_to_best  -52.7393  8.83739  7.46887  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -52.7393  8.83739  7.46887  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.7393  8.83739  7.46887  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.1478  8.83739  7.46887  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -68.3609  8.83739  7.46887  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.1781  8.83739  7.46887  0.02805
protocols.relax.FastRelax: {0} CMD: min  -70.294  8.9675  7.65007  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -70.294  8.9675  7.65007  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -63.9718  8.9675  7.65007  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -64.1775  8.9675  7.65007  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -63.7521  8.9675  7.65007  0.154
protocols.relax.FastRelax: {0} CMD: min  -65.8448  8.88686  7.59145  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -65.8448  8.88686  7.59145  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -59.2249  8.88686  7.59145  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 623 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -58.9422  8.88686  7.59145  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.3825  8.88686  7.59145  0.31955
protocols.relax.FastRelax: {0} CMD: min  -59.2653  8.87436  7.53095  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -59.2653  8.87436  7.53095  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.6587  8.87436  7.53095  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 616 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.6717  8.87436  7.53095  0.55
protocols.relax.FastRelax: {0} CMD: min  -53.0631  8.84247  7.47571  0.55
protocols.relax.FastRelax: {0} MRP: 2  -53.0631  -53.0631  8.84247  7.47571
protocols.relax.FastRelax: {0} CMD: accept_to_best  -53.0631  8.84247  7.47571  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -53.0631  8.84247  7.47571  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -53.0631  8.84247  7.47571  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.6422  8.84247  7.47571  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -69.0788  8.84247  7.47571  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.8749  8.84247  7.47571  0.02805
protocols.relax.FastRelax: {0} CMD: min  -71.0286  8.96031  7.64303  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -71.0286  8.96031  7.64303  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -64.4804  8.96031  7.64303  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 640 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -64.7856  8.96031  7.64303  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -64.341  8.96031  7.64303  0.154
protocols.relax.FastRelax: {0} CMD: min  -66.2382  8.88408  7.58073  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -66.2382  8.88408  7.58073  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -59.1679  8.88408  7.58073  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 622 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -59.1679  8.88408  7.58073  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.6104  8.88408  7.58073  0.31955
protocols.relax.FastRelax: {0} CMD: min  -59.7157  8.86447  7.52836  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -59.7157  8.86447  7.52836  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -51.2054  8.86447  7.52836  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 617 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -51.2321  8.86447  7.52836  0.55
protocols.relax.FastRelax: {0} CMD: min  -53.1417  8.83258  7.46191  0.55
protocols.relax.FastRelax: {0} MRP: 3  -53.1417  -53.1417  8.83258  7.46191
protocols.relax.FastRelax: {0} CMD: accept_to_best  -53.1417  8.83258  7.46191  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -53.1417  8.83258  7.46191  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -53.1417  8.83258  7.46191  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.7023  8.83258  7.46191  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -69.0133  8.83258  7.46191  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.8139  8.83258  7.46191  0.02805
protocols.relax.FastRelax: {0} CMD: min  -71.0947  8.95477  7.6352  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -71.0947  8.95477  7.6352  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -64.3784  8.95477  7.6352  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 640 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -64.6656  8.95477  7.6352  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -64.2119  8.95477  7.6352  0.154
protocols.relax.FastRelax: {0} CMD: min  -66.5057  8.88928  7.57796  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -66.5057  8.88928  7.57796  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.9505  8.88928  7.57796  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 615 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -58.9711  8.88928  7.57796  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.3796  8.88928  7.57796  0.31955
protocols.relax.FastRelax: {0} CMD: min  -59.7633  8.83508  7.47682  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -59.7633  8.83508  7.47682  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -51.2102  8.83508  7.47682  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 614 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -51.2489  8.83508  7.47682  0.55
protocols.relax.FastRelax: {0} CMD: min  -53.1423  8.83211  7.46197  0.55
protocols.relax.FastRelax: {0} MRP: 4  -53.1423  -53.1423  8.83211  7.46197
protocols.relax.FastRelax: {0} CMD: accept_to_best  -53.1423  8.83211  7.46197  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -53.1423  8.83211  7.46197  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_46.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14964.1  7.75248  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14964.1  7.75248  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2335.58  7.75248  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 773 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  99.8194  7.75248  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  111.594  7.75248  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  2.92429  8.02022  3.46914  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  2.92429  8.02022  3.46914  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  130.793  8.02022  3.46914  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 761 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  105.961  8.02022  3.46914  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  112.955  8.02022  3.46914  0.154
protocols.relax.FastRelax: {0} CMD: min  -22.9502  8.69886  4.51273  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.9502  8.69886  4.51273  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.7991  8.69886  4.51273  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 736 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.5405  8.69886  4.51273  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.9371  8.69886  4.51273  0.31955
protocols.relax.FastRelax: {0} CMD: min  -15.9925  8.70954  4.50755  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.9925  8.70954  4.50755  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.86998  8.70954  4.50755  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 748 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -6.87031  8.70954  4.50755  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.5618  9.37508  5.73537  0.55
protocols.relax.FastRelax: {0} MRP: 0  -19.5618  -19.5618  9.37508  5.73537
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.5618  9.37508  5.73537  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.5618  9.37508  5.73537  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.5618  9.37508  5.73537  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.9686  9.37508  5.73537  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 705 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.3287  9.37508  5.73537  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.8274  9.37508  5.73537  0.02805
protocols.relax.FastRelax: {0} CMD: min  -41.271  9.38928  5.95362  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.271  9.38928  5.95362  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.8598  9.38928  5.95362  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 793 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.5413  9.38928  5.95362  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.3436  9.38928  5.95362  0.154
protocols.relax.FastRelax: {0} CMD: min  -33.5829  9.38531  5.80003  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.5829  9.38531  5.80003  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9049  9.38531  5.80003  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 739 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9136  9.38531  5.80003  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.3089  9.38531  5.80003  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.877  9.38708  5.79331  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.877  9.38708  5.79331  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.5879  9.38708  5.79331  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 732 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.6377  9.38708  5.79331  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.0063  9.40969  5.79384  0.55
protocols.relax.FastRelax: {0} MRP: 1  -20.0063  -20.0063  9.40969  5.79384
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.0063  9.40969  5.79384  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.0063  9.40969  5.79384  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.0063  9.40969  5.79384  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.6248  9.40969  5.79384  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 701 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.8976  9.40969  5.79384  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.4428  9.40969  5.79384  0.02805
protocols.relax.FastRelax: {0} CMD: min  -39.9784  9.43217  5.84172  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.9784  9.43217  5.84172  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.8608  9.43217  5.84172  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.9547  9.43217  5.84172  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.3043  9.43217  5.84172  0.154
protocols.relax.FastRelax: {0} CMD: min  -34.0017  9.40235  5.83994  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.0017  9.40235  5.83994  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.1012  9.40235  5.83994  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 736 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.1037  9.40235  5.83994  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.481  9.40235  5.83994  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.2004  9.39613  5.82393  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.2004  9.39613  5.82393  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.059  9.39613  5.82393  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 728 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.2267  9.39613  5.82393  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.0071  9.41407  5.80631  0.55
protocols.relax.FastRelax: {0} MRP: 2  -20.0071  -20.0071  9.41407  5.80631
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.0071  9.41407  5.80631  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.0071  9.41407  5.80631  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.0071  9.41407  5.80631  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.6464  9.41407  5.80631  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.9188  9.41407  5.80631  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.4605  9.41407  5.80631  0.02805
protocols.relax.FastRelax: {0} CMD: min  -39.9741  9.43652  5.85348  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.9741  9.43652  5.85348  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.0168  9.43652  5.85348  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.1824  9.43652  5.85348  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.5476  9.43652  5.85348  0.154
protocols.relax.FastRelax: {0} CMD: min  -33.9472  9.41011  5.86295  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.9472  9.41011  5.86295  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.8862  9.41011  5.86295  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 736 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.8887  9.41011  5.86295  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2533  9.41011  5.86295  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.0641  9.4006  5.84351  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.0641  9.4006  5.84351  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.8301  9.4006  5.84351  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 728 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.0236  9.4006  5.84351  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.0066  9.41538  5.80995  0.55
protocols.relax.FastRelax: {0} MRP: 3  -20.0066  -20.0071  9.41407  5.80631
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.0066  9.41538  5.80995  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.0066  9.41538  5.80995  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.0066  9.41538  5.80995  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.6459  9.41538  5.80995  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.0126  9.41538  5.80995  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.4975  9.41538  5.80995  0.02805
protocols.relax.FastRelax: {0} CMD: min  -47.3249  9.60207  6.29117  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.3249  9.60207  6.29117  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.0539  9.60207  6.29117  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 791 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.5348  9.60207  6.29117  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.1363  9.60207  6.29117  0.154
protocols.relax.FastRelax: {0} CMD: min  -35.7623  9.56159  6.18991  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.7623  9.56159  6.18991  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.3103  9.56159  6.18991  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 744 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.3104  9.56159  6.18991  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.565  9.56159  6.18991  0.31955
protocols.relax.FastRelax: {0} CMD: min  -28.3624  9.55434  6.13906  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.3624  9.55434  6.13906  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.8485  9.55434  6.13906  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.8485  9.55434  6.13906  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.058  9.4735  6.03073  0.55
protocols.relax.FastRelax: {0} MRP: 4  -22.058  -22.058  9.4735  6.03073
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.058  9.4735  6.03073  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.058  9.4735  6.03073  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_26.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14506.3  10.2463  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14506.3  10.2463  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1843.38  10.2463  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 601 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  115.212  10.2463  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  130.008  10.2463  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  59.7133  10.1876  2.6526  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  59.7133  10.1876  2.6526  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  73.4575  10.1876  2.6526  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 606 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  64.3302  10.1876  2.6526  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  65.22  10.1876  2.6526  0.154
protocols.relax.FastRelax: {0} CMD: min  12.4965  9.80513  6.39985  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  12.4965  9.80513  6.39985  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  19.0974  9.80513  6.39985  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 685 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  16.7238  9.80513  6.39985  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  17.1774  9.80513  6.39985  0.31955
protocols.relax.FastRelax: {0} CMD: min  5.28984  9.57102  9.6354  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  5.28984  9.57102  9.6354  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  12.4901  9.57102  9.6354  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  10.2018  9.57102  9.6354  0.55
core.optimization.LineMinimizer: {0} [ ERROR ] Inaccurate G! step= 3.8147e-06 Deriv= -0.0108462 Finite Diff= 0.00618093
protocols.relax.FastRelax: {0} CMD: min  3.29149  8.2961  11.5995  0.55
protocols.relax.FastRelax: {0} MRP: 0  3.29149  3.29149  8.2961  11.5995
protocols.relax.FastRelax: {0} CMD: accept_to_best  3.29149  8.2961  11.5995  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  3.29149  8.2961  11.5995  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  3.29149  8.2961  11.5995  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.8131  8.2961  11.5995  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 694 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.6772  8.2961  11.5995  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.3322  8.2961  11.5995  0.02805
protocols.relax.FastRelax: {0} CMD: min  -18.4911  8.34247  11.3046  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.4911  8.34247  11.3046  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.98349  8.34247  11.3046  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.71965  8.34247  11.3046  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.78599  8.34247  11.3046  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.1892  8.4518  10.9659  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.1892  8.4518  10.9659  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.38818  8.4518  10.9659  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -7.46995  8.4518  10.9659  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.86849  8.4518  10.9659  0.31955
protocols.relax.FastRelax: {0} CMD: min  -8.52855  8.43212  11.0585  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.52855  8.43212  11.0585  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.207688  8.43212  11.0585  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 632 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.213158  8.43212  11.0585  0.55
protocols.relax.FastRelax: {0} CMD: min  -2.4767  8.75959  11.6405  0.55
protocols.relax.FastRelax: {0} MRP: 1  -2.4767  -2.4767  8.75959  11.6405
protocols.relax.FastRelax: {0} CMD: accept_to_best  -2.4767  8.75959  11.6405  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -2.4767  8.75959  11.6405  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -2.4767  8.75959  11.6405  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.9469  8.75959  11.6405  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.3026  8.75959  11.6405  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.0967  8.75959  11.6405  0.02805
protocols.relax.FastRelax: {0} CMD: min  -25.9868  8.85606  11.7272  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.9868  8.85606  11.7272  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.54897  8.85606  11.7272  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 657 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.97417  8.85606  11.7272  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.84838  8.85606  11.7272  0.154
protocols.relax.FastRelax: {0} CMD: min  -16.1464  8.82186  11.5691  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.1464  8.82186  11.5691  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.78889  8.82186  11.5691  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -7.91866  8.82186  11.5691  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.27887  8.82186  11.5691  0.31955
protocols.relax.FastRelax: {0} CMD: min  -9.17322  8.77197  11.5068  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.17322  8.77197  11.5068  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.718413  8.77197  11.5068  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.807653  8.77197  11.5068  0.55
protocols.relax.FastRelax: {0} CMD: min  -2.34166  8.76435  11.5467  0.55
protocols.relax.FastRelax: {0} MRP: 2  -2.34166  -2.4767  8.75959  11.6405
protocols.relax.FastRelax: {0} CMD: accept_to_best  -2.34166  8.76435  11.5467  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -2.34166  8.76435  11.5467  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -2.34166  8.76435  11.5467  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.8016  8.76435  11.5467  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.3198  8.76435  11.5467  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.1148  8.76435  11.5467  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.2043  8.85343  11.5979  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.2043  8.85343  11.5979  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.33882  8.85343  11.5979  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.63931  8.85343  11.5979  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.48782  8.85343  11.5979  0.154
protocols.relax.FastRelax: {0} CMD: min  -16.1726  8.82404  11.4631  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.1726  8.82404  11.4631  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.85803  8.82404  11.4631  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.04788  8.82404  11.4631  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.41647  8.82404  11.4631  0.31955
protocols.relax.FastRelax: {0} CMD: min  -9.1637  8.79219  11.4381  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.1637  8.79219  11.4381  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.729983  8.79219  11.4381  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.790847  8.79219  11.4381  0.55
protocols.relax.FastRelax: {0} CMD: min  -2.3413  8.76564  11.5477  0.55
protocols.relax.FastRelax: {0} MRP: 3  -2.3413  -2.4767  8.75959  11.6405
protocols.relax.FastRelax: {0} CMD: accept_to_best  -2.3413  8.76564  11.5477  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -2.3413  8.76564  11.5477  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -2.3413  8.76564  11.5477  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.8012  8.76564  11.5477  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.3812  8.76564  11.5477  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.1756  8.76564  11.5477  0.02805
protocols.relax.FastRelax: {0} CMD: min  -26.1817  8.85465  11.638  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.1817  8.85465  11.638  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.10354  8.85465  11.638  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 654 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.13992  8.85465  11.638  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.00483  8.85465  11.638  0.154
protocols.relax.FastRelax: {0} CMD: min  -16.2125  8.84162  11.5449  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.2125  8.84162  11.5449  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.9781  8.84162  11.5449  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.10631  8.84162  11.5449  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.47558  8.84162  11.5449  0.31955
protocols.relax.FastRelax: {0} CMD: min  -9.2916  8.7662  11.4684  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.2916  8.7662  11.4684  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.857163  8.7662  11.4684  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.945587  8.7662  11.4684  0.55
protocols.relax.FastRelax: {0} CMD: min  -2.47422  8.75492  11.6282  0.55
protocols.relax.FastRelax: {0} MRP: 4  -2.47422  -2.4767  8.75959  11.6405
protocols.relax.FastRelax: {0} CMD: accept_to_best  -2.47422  8.75492  11.6282  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -2.47422  8.75492  11.6282  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_22.pdb
protocols.relax.FastRelax: {0} CMD: repeat  17925.6  7.33612  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  17925.6  7.33612  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2492.3  7.33612  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 720 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  94.9062  7.33612  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  117.569  7.33612  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.0646  7.69896  2.09388  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.0646  7.69896  2.09388  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.70459  7.69896  2.09388  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 979 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.77894  7.69896  2.09388  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.33124  7.69896  2.09388  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.2451  8.16414  3.82433  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.2451  8.16414  3.82433  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4107  8.16414  3.82433  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 930 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.8161  8.16414  3.82433  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7456  8.16414  3.82433  0.31955
protocols.relax.FastRelax: {0} CMD: min  -29.4815  8.15328  3.73737  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.4815  8.15328  3.73737  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7811  8.15328  3.73737  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 971 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7818  8.15328  3.73737  0.55
protocols.relax.FastRelax: {0} CMD: min  -31.3886  9.03494  7.22166  0.55
protocols.relax.FastRelax: {0} MRP: 0  -31.3886  -31.3886  9.03494  7.22166
protocols.relax.FastRelax: {0} CMD: accept_to_best  -31.3886  9.03494  7.22166  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -31.3886  9.03494  7.22166  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.3886  9.03494  7.22166  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.6562  9.03494  7.22166  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1004 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -55.1883  9.03494  7.22166  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -54.2746  9.03494  7.22166  0.02805
protocols.relax.FastRelax: {0} CMD: min  -69.2807  9.19189  7.37468  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -69.2807  9.19189  7.37468  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.2463  9.19189  7.37468  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1028 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.1428  9.19189  7.37468  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.6084  9.19189  7.37468  0.154
protocols.relax.FastRelax: {0} CMD: min  -51.7942  9.12439  7.30789  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -51.7942  9.12439  7.30789  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.6697  9.12439  7.30789  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1061 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.1399  9.12439  7.30789  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.1445  9.12439  7.30789  0.31955
protocols.relax.FastRelax: {0} CMD: min  -48.5582  9.01375  7.40831  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -48.5582  9.01375  7.40831  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.681  9.01375  7.40831  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 975 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.6968  9.01375  7.40831  0.55
protocols.relax.FastRelax: {0} CMD: min  -42.4254  8.96917  7.40589  0.55
protocols.relax.FastRelax: {0} MRP: 1  -42.4254  -42.4254  8.96917  7.40589
protocols.relax.FastRelax: {0} CMD: accept_to_best  -42.4254  8.96917  7.40589  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -42.4254  8.96917  7.40589  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.4254  8.96917  7.40589  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -61.1538  8.96917  7.40589  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 985 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -63.9031  8.96917  7.40589  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -62.8846  8.96917  7.40589  0.02805
protocols.relax.FastRelax: {0} CMD: min  -73.5477  9.07282  7.70155  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -73.5477  9.07282  7.70155  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.6264  9.07282  7.70155  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 975 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.7964  9.07282  7.70155  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.3001  9.07282  7.70155  0.154
protocols.relax.FastRelax: {0} CMD: min  -60.1982  9.18143  7.708  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -60.1982  9.18143  7.708  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.0511  9.18143  7.708  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 960 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -47.958  9.18143  7.708  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.0439  9.18143  7.708  0.31955
protocols.relax.FastRelax: {0} CMD: min  -50.0187  9.14467  7.63496  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.0187  9.14467  7.63496  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.7231  9.14467  7.63496  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1007 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.9732  9.14467  7.63496  0.55
protocols.relax.FastRelax: {0} CMD: min  -43.6719  9.02875  7.42993  0.55
protocols.relax.FastRelax: {0} MRP: 2  -43.6719  -43.6719  9.02875  7.42993
protocols.relax.FastRelax: {0} CMD: accept_to_best  -43.6719  9.02875  7.42993  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -43.6719  9.02875  7.42993  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.6719  9.02875  7.42993  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -62.474  9.02875  7.42993  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 987 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -65.0279  9.02875  7.42993  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -63.9461  9.02875  7.42993  0.02805
protocols.relax.FastRelax: {0} CMD: min  -72.0677  8.99016  7.43821  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -72.0677  8.99016  7.43821  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.1117  8.99016  7.43821  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 989 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -56.8659  8.99016  7.43821  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -56.0408  8.99016  7.43821  0.154
protocols.relax.FastRelax: {0} CMD: min  -60.7007  9.08807  7.48296  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -60.7007  9.08807  7.48296  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.6817  9.08807  7.48296  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 947 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.7002  9.08807  7.48296  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.8339  9.08807  7.48296  0.31955
protocols.relax.FastRelax: {0} CMD: min  -50.6876  9.10696  7.44423  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.6876  9.10696  7.44423  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.8651  9.10696  7.44423  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 946 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.9551  9.10696  7.44423  0.55
protocols.relax.FastRelax: {0} CMD: min  -43.7322  9.03045  7.42498  0.55
protocols.relax.FastRelax: {0} MRP: 3  -43.7322  -43.7322  9.03045  7.42498
protocols.relax.FastRelax: {0} CMD: accept_to_best  -43.7322  9.03045  7.42498  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -43.7322  9.03045  7.42498  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.7322  9.03045  7.42498  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -62.5219  9.03045  7.42498  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 980 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -64.9305  9.03045  7.42498  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -63.8169  9.03045  7.42498  0.02805
protocols.relax.FastRelax: {0} CMD: min  -73.7388  9.02305  7.49093  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -73.7388  9.02305  7.49093  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.9869  9.02305  7.49093  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 986 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -51.7701  9.02305  7.49093  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.4648  9.02305  7.49093  0.154
protocols.relax.FastRelax: {0} CMD: min  -60.1463  9.11613  7.48734  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -60.1463  9.11613  7.48734  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.5255  9.11613  7.48734  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1005 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.7918  9.11613  7.48734  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.9267  9.11613  7.48734  0.31955
protocols.relax.FastRelax: {0} CMD: min  -50.2996  9.04133  7.43545  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.2996  9.04133  7.43545  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.201  9.04133  7.43545  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 960 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.202  9.04133  7.43545  0.55
protocols.relax.FastRelax: {0} CMD: min  -43.7334  9.04412  7.40328  0.55
protocols.relax.FastRelax: {0} MRP: 4  -43.7334  -43.7334  9.04412  7.40328
protocols.relax.FastRelax: {0} CMD: accept_to_best  -43.7334  9.04412  7.40328  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -43.7334  9.04412  7.40328  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_44.pdb
protocols.relax.FastRelax: {0} CMD: repeat  10940.2  9.20145  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  10940.2  9.20145  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1605.46  9.20145  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 617 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  92.4032  9.20145  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  100.476  9.20145  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -17.4168  7.77915  5.04596  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.4168  7.77915  5.04596  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  10.9125  7.77915  5.04596  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.20938  7.77915  5.04596  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.778749  7.77915  5.04596  0.154
protocols.relax.FastRelax: {0} CMD: min  -21.1981  7.71327  5.9274  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.1981  7.71327  5.9274  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.8722  7.71327  5.9274  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 681 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.1297  7.71327  5.9274  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.4179  7.71327  5.9274  0.31955
protocols.relax.FastRelax: {0} CMD: min  -13.321  7.7285  5.88978  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.321  7.7285  5.88978  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.23691  7.7285  5.88978  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 660 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.38663  7.7285  5.88978  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.9724  8.00503  7.32596  0.55
protocols.relax.FastRelax: {0} MRP: 0  -16.9724  -16.9724  8.00503  7.32596
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.9724  8.00503  7.32596  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.9724  8.00503  7.32596  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.9724  8.00503  7.32596  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.8836  8.00503  7.32596  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.3425  8.00503  7.32596  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1637  8.00503  7.32596  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.365  8.35249  8.22281  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.365  8.35249  8.22281  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.3352  8.35249  8.22281  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.9003  8.35249  8.22281  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.4805  8.35249  8.22281  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.672  8.15298  7.96754  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.672  8.15298  7.96754  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.1085  8.15298  7.96754  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.1199  8.15298  7.96754  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.5254  8.15298  7.96754  0.31955
protocols.relax.FastRelax: {0} CMD: min  -24.9209  8.14723  7.97418  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.9209  8.14723  7.97418  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.4553  8.14723  7.97418  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 628 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.4668  8.14723  7.97418  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.103  8.17912  8.08503  0.55
protocols.relax.FastRelax: {0} MRP: 1  -20.103  -20.103  8.17912  8.08503
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.103  8.17912  8.08503  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.103  8.17912  8.08503  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.103  8.17912  8.08503  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.7055  8.17912  8.08503  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.7759  8.17912  8.08503  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5301  8.17912  8.08503  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.2964  8.19704  8.08812  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.2964  8.19704  8.08812  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.8376  8.19704  8.08812  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.8718  8.19704  8.08812  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.8873  8.19704  8.08812  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.6542  8.22883  8.09788  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.6542  8.22883  8.09788  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5752  8.22883  8.09788  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.7027  8.22883  8.09788  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2044  8.22883  8.09788  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.5654  8.22525  8.11002  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.5654  8.22525  8.11002  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7419  8.22525  8.11002  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7537  8.22525  8.11002  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.1031  8.17546  8.07755  0.55
protocols.relax.FastRelax: {0} MRP: 2  -20.1031  -20.1031  8.17546  8.07755
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.1031  8.17546  8.07755  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.1031  8.17546  8.07755  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.1031  8.17546  8.07755  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.6904  8.17546  8.07755  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.764  8.17546  8.07755  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.522  8.17546  8.07755  0.02805
protocols.relax.FastRelax: {0} CMD: min  -36.9905  8.18427  8.10258  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.9905  8.18427  8.10258  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.1319  8.18427  8.10258  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.2451  8.18427  8.10258  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.2345  8.18427  8.10258  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.5088  8.21881  8.08464  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.5088  8.21881  8.08464  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5283  8.21881  8.08464  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.5499  8.21881  8.08464  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.0064  8.21881  8.08464  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.3837  8.22248  8.08604  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.3837  8.22248  8.08604  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.691  8.22248  8.08604  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.6397  8.22248  8.08604  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.1059  8.17467  8.06967  0.55
protocols.relax.FastRelax: {0} MRP: 3  -20.1059  -20.1059  8.17467  8.06967
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.1059  8.17467  8.06967  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.1059  8.17467  8.06967  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.1059  8.17467  8.06967  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.6868  8.17467  8.06967  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.7376  8.17467  8.06967  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.4945  8.17467  8.06967  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.2578  8.16628  8.12985  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.2578  8.16628  8.12985  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.5336  8.16628  8.12985  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.4894  8.16628  8.12985  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.7164  8.16628  8.12985  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.834  8.20698  8.10767  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.834  8.20698  8.10767  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9261  8.20698  8.10767  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9268  8.20698  8.10767  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.4612  8.20698  8.10767  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.7645  8.2021  8.10754  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7645  8.2021  8.10754  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.4935  8.2021  8.10754  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.5034  8.2021  8.10754  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.104  8.17404  8.06728  0.55
protocols.relax.FastRelax: {0} MRP: 4  -20.104  -20.1059  8.17467  8.06967
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.104  8.17404  8.06728  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.104  8.17404  8.06728  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_14.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14380.1  8.33464  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14380.1  8.33464  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1837.44  8.33464  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 646 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  71.1031  8.33464  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  85.5245  8.33464  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -49.8686  7.91492  3.45169  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.8686  7.91492  3.45169  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.8062  7.91492  3.45169  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 830 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.5194  7.91492  3.45169  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.6029  7.91492  3.45169  0.154
protocols.relax.FastRelax: {0} CMD: min  -41.449  7.8459  3.36653  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.449  7.8459  3.36653  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.3426  7.8459  3.36653  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 782 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.4458  7.8459  3.36653  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.5674  7.8459  3.36653  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.1074  7.84522  3.35194  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.1074  7.84522  3.35194  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.3145  7.84522  3.35194  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 753 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.6062  7.84522  3.35194  0.55
protocols.relax.FastRelax: {0} CMD: min  -27.4033  7.78447  3.69503  0.55
protocols.relax.FastRelax: {0} MRP: 0  -27.4033  -27.4033  7.78447  3.69503
protocols.relax.FastRelax: {0} CMD: accept_to_best  -27.4033  7.78447  3.69503  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -27.4033  7.78447  3.69503  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.4033  7.78447  3.69503  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.5343  7.78447  3.69503  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 852 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.3475  7.78447  3.69503  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.9359  7.78447  3.69503  0.02805
protocols.relax.FastRelax: {0} CMD: min  -62.8288  7.72186  3.72317  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -62.8288  7.72186  3.72317  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.4394  7.72186  3.72317  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 816 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.7685  7.72186  3.72317  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.3897  7.72186  3.72317  0.154
protocols.relax.FastRelax: {0} CMD: min  -50.7628  7.73906  3.75925  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.7628  7.73906  3.75925  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.8041  7.73906  3.75925  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 798 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.8054  7.73906  3.75925  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.9413  7.73906  3.75925  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.1604  7.75442  3.74431  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.1604  7.75442  3.74431  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.1836  7.75442  3.74431  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 768 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.2306  7.75442  3.74431  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.9776  7.95746  4.05282  0.55
protocols.relax.FastRelax: {0} MRP: 1  -35.9776  -35.9776  7.95746  4.05282
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.9776  7.95746  4.05282  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.9776  7.95746  4.05282  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.9776  7.95746  4.05282  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -54.9314  7.95746  4.05282  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 809 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -56.26  7.95746  4.05282  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -55.9094  7.95746  4.05282  0.02805
protocols.relax.FastRelax: {0} CMD: min  -61.1692  7.86463  4.18803  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -61.1692  7.86463  4.18803  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.0286  7.86463  4.18803  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 773 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -47.4399  7.86463  4.18803  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.4858  7.86463  4.18803  0.154
protocols.relax.FastRelax: {0} CMD: min  -52.5116  7.90564  4.10152  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.5116  7.90564  4.10152  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.4559  7.90564  4.10152  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 738 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.4576  7.90564  4.10152  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.7438  7.90564  4.10152  0.31955
protocols.relax.FastRelax: {0} CMD: min  -43.2912  7.91141  4.09117  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2912  7.91141  4.09117  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.6634  7.91141  4.09117  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 724 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6644  7.91141  4.09117  0.55
protocols.relax.FastRelax: {0} CMD: min  -38.8152  7.9574  3.89942  0.55
protocols.relax.FastRelax: {0} MRP: 2  -38.8152  -38.8152  7.9574  3.89942
protocols.relax.FastRelax: {0} CMD: accept_to_best  -38.8152  7.9574  3.89942  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -38.8152  7.9574  3.89942  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.8152  7.9574  3.89942  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.4424  7.9574  3.89942  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 810 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -59.394  7.9574  3.89942  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -59.0254  7.9574  3.89942  0.02805
protocols.relax.FastRelax: {0} CMD: min  -65.3353  7.83834  4.03351  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -65.3353  7.83834  4.03351  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.856  7.83834  4.03351  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 788 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.5408  7.83834  4.03351  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.1336  7.83834  4.03351  0.154
protocols.relax.FastRelax: {0} CMD: min  -54.721  7.91255  3.98136  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.721  7.91255  3.98136  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.5761  7.91255  3.98136  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 761 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -45.6266  7.91255  3.98136  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.8252  7.91255  3.98136  0.31955
protocols.relax.FastRelax: {0} CMD: min  -46.786  7.94277  3.95176  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.786  7.94277  3.95176  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.3377  7.94277  3.95176  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 738 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.3604  7.94277  3.95176  0.55
protocols.relax.FastRelax: {0} CMD: min  -39.295  7.93007  3.84567  0.55
protocols.relax.FastRelax: {0} MRP: 3  -39.295  -39.295  7.93007  3.84567
protocols.relax.FastRelax: {0} CMD: accept_to_best  -39.295  7.93007  3.84567  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -39.295  7.93007  3.84567  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.295  7.93007  3.84567  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.7165  7.93007  3.84567  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 832 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -59.9529  7.93007  3.84567  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -59.5417  7.93007  3.84567  0.02805
protocols.relax.FastRelax: {0} CMD: min  -63.5034  7.81569  3.93707  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -63.5034  7.81569  3.93707  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.0063  7.81569  3.93707  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 800 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.9267  7.81569  3.93707  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.9294  7.81569  3.93707  0.154
protocols.relax.FastRelax: {0} CMD: min  -55.4349  7.86804  3.90386  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -55.4349  7.86804  3.90386  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.1815  7.86804  3.90386  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 780 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -46.7816  7.86804  3.90386  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.0558  7.86804  3.90386  0.31955
protocols.relax.FastRelax: {0} CMD: min  -46.6409  7.87117  3.9005  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.6409  7.87117  3.9005  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.8031  7.87117  3.9005  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 744 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.8062  7.87117  3.9005  0.55
protocols.relax.FastRelax: {0} CMD: min  -40.8232  7.9367  3.86474  0.55
protocols.relax.FastRelax: {0} MRP: 4  -40.8232  -40.8232  7.9367  3.86474
protocols.relax.FastRelax: {0} CMD: accept_to_best  -40.8232  7.9367  3.86474  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -40.8232  7.9367  3.86474  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_12.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14637.8  7.02406  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14637.8  7.02406  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1832.43  7.02406  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 698 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  56.8885  7.02406  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  62.9561  7.02406  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  166.476  8.00706  4.76828  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  166.476  8.00706  4.76828  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  977.646  8.00706  4.76828  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 684 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  605.651  8.00706  4.76828  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  641.683  8.00706  4.76828  0.154
protocols.relax.FastRelax: {0} CMD: min  -20.472  8.36251  5.17487  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.472  8.36251  5.17487  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.0123  8.36251  5.17487  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.5118  8.36251  5.17487  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.8036  8.36251  5.17487  0.31955
protocols.relax.FastRelax: {0} CMD: min  -15.5521  8.51448  5.32334  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.5521  8.51448  5.32334  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.0806  8.51448  5.32334  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 657 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -7.14495  8.51448  5.32334  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.4449  8.7229  5.08343  0.55
protocols.relax.FastRelax: {0} MRP: 0  -26.4449  -26.4449  8.7229  5.08343
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.4449  8.7229  5.08343  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.4449  8.7229  5.08343  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.4449  8.7229  5.08343  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.0553  8.7229  5.08343  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 736 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.6917  8.7229  5.08343  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.9674  8.7229  5.08343  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.4812  8.74731  5.08921  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.4812  8.74731  5.08921  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4044  8.74731  5.08921  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.3548  8.74731  5.08921  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.9445  8.74731  5.08921  0.154
protocols.relax.FastRelax: {0} CMD: min  -37.0551  8.74788  5.09358  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.0551  8.74788  5.09358  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.47  8.74788  5.09358  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.5382  8.74788  5.09358  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.9506  8.74788  5.09358  0.31955
protocols.relax.FastRelax: {0} CMD: min  -35.2848  8.95135  5.21289  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.2848  8.95135  5.21289  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2312  8.95135  5.21289  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.2567  8.95135  5.21289  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.9479  9.10885  5.31048  0.55
protocols.relax.FastRelax: {0} MRP: 1  -35.9479  -35.9479  9.10885  5.31048
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.9479  9.10885  5.31048  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.9479  9.10885  5.31048  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.9479  9.10885  5.31048  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.1974  9.10885  5.31048  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 757 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.6539  9.10885  5.31048  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.0137  9.10885  5.31048  0.02805
protocols.relax.FastRelax: {0} CMD: min  -50.2313  9.11271  5.3119  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.2313  9.11271  5.3119  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.6708  9.11271  5.3119  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 716 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.4252  9.11271  5.3119  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.8678  9.11271  5.3119  0.154
protocols.relax.FastRelax: {0} CMD: min  -43.2663  9.13492  5.29257  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2663  9.13492  5.29257  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.9108  9.13492  5.29257  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 705 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.1086  9.13492  5.29257  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.535  9.13492  5.29257  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.6521  9.13174  5.36858  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.6521  9.13174  5.36858  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31  9.13174  5.36858  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 684 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.0046  9.13174  5.36858  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.9921  9.10292  5.33097  0.55
protocols.relax.FastRelax: {0} MRP: 2  -35.9921  -35.9921  9.10292  5.33097
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.9921  9.10292  5.33097  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.9921  9.10292  5.33097  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.9921  9.10292  5.33097  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.3096  9.10292  5.33097  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 754 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -50.5733  9.10292  5.33097  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.9223  9.10292  5.33097  0.02805
protocols.relax.FastRelax: {0} CMD: min  -50.1384  9.10675  5.3323  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -50.1384  9.10675  5.3323  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.3681  9.10675  5.3323  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 712 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.3216  9.10675  5.3323  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.7551  9.10675  5.3323  0.154
protocols.relax.FastRelax: {0} CMD: min  -43.2346  9.13139  5.31182  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.2346  9.13139  5.31182  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.8585  9.13139  5.31182  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 703 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.0831  9.13139  5.31182  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5073  9.13139  5.31182  0.31955
protocols.relax.FastRelax: {0} CMD: min  -39.2439  9.1061  5.35259  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.2439  9.1061  5.35259  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7564  9.1061  5.35259  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 684 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.7564  9.1061  5.35259  0.55
protocols.relax.FastRelax: {0} CMD: min  -32.1634  9.09966  5.34032  0.55
protocols.relax.FastRelax: {0} MRP: 3  -32.1634  -35.9921  9.10292  5.33097
protocols.relax.FastRelax: {0} CMD: accept_to_best  -32.1634  9.09966  5.34032  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -32.1634  9.09966  5.34032  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.1634  9.09966  5.34032  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.0067  9.09966  5.34032  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 756 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.5604  9.09966  5.34032  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -49.0586  9.09966  5.34032  0.02805
protocols.relax.FastRelax: {0} CMD: min  -49.5875  9.10744  5.33115  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.5875  9.10744  5.33115  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.5829  9.10744  5.33115  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 713 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.6668  9.10744  5.33115  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.3603  9.10744  5.33115  0.154
protocols.relax.FastRelax: {0} CMD: min  -44.4963  9.10947  5.3325  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.4963  9.10947  5.3325  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.729  9.10947  5.3325  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 705 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.6342  9.10947  5.3325  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.2525  9.10947  5.3325  0.31955
protocols.relax.FastRelax: {0} CMD: min  -39.2656  9.10917  5.33191  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.2656  9.10917  5.33191  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.978  9.10917  5.33191  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 683 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.978  9.10917  5.33191  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.9919  9.1033  5.32983  0.55
protocols.relax.FastRelax: {0} MRP: 4  -35.9919  -35.9921  9.10292  5.33097
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.9919  9.1033  5.32983  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.9919  9.1033  5.32983  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_7.pdb
protocols.relax.FastRelax: {0} CMD: repeat  12370.6  6.0802  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  12370.6  6.0802  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2298.9  6.0802  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 684 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  61.3925  6.0802  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  63.4077  6.0802  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  63.3476  6.08053  0.00958421  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  63.3476  6.08053  0.00958421  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  102.463  6.08053  0.00958421  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  87.3654  6.08053  0.00958421  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  88.5272  6.08053  0.00958421  0.154
protocols.relax.FastRelax: {0} CMD: min  35.7112  6.34855  2.61013  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  35.7112  6.34855  2.61013  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  46.9116  6.34855  2.61013  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  34.896  6.34855  2.61013  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  35.3584  6.34855  2.61013  0.31955
protocols.relax.FastRelax: {0} CMD: min  35.2482  6.34588  2.61348  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  35.2482  6.34588  2.61348  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  44.0578  6.34588  2.61348  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 644 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  43.8171  6.34588  2.61348  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.2797  7.26287  4.55708  0.55
protocols.relax.FastRelax: {0} MRP: 0  -10.2797  -10.2797  7.26287  4.55708
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.2797  7.26287  4.55708  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.2797  7.26287  4.55708  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.2797  7.26287  4.55708  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.9447  7.26287  4.55708  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 650 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.5688  7.26287  4.55708  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.3783  7.26287  4.55708  0.02805
protocols.relax.FastRelax: {0} CMD: min  -27.4442  7.2573  4.55553  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.4442  7.2573  4.55553  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.6091  7.2573  4.55553  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 618 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.8309  7.2573  4.55553  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.5986  7.2573  4.55553  0.154
protocols.relax.FastRelax: {0} CMD: min  -23.6099  7.25764  4.55605  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.6099  7.25764  4.55605  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.2917  7.25764  4.55605  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 612 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.3124  7.25764  4.55605  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.9736  7.25764  4.55605  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.011  7.26125  4.55762  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.011  7.26125  4.55762  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.6045  7.26125  4.55762  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.6224  7.26125  4.55762  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.6449  7.89822  5.56875  0.55
protocols.relax.FastRelax: {0} MRP: 1  -20.6449  -20.6449  7.89822  5.56875
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.6449  7.89822  5.56875  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.6449  7.89822  5.56875  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.6449  7.89822  5.56875  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1866  7.89822  5.56875  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.1575  7.89822  5.56875  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9728  7.89822  5.56875  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.0404  7.89678  5.5703  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.0404  7.89678  5.5703  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4204  7.89678  5.5703  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 614 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.5458  7.89678  5.5703  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.3222  7.89678  5.5703  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.3542  7.89956  5.57291  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3542  7.89956  5.57291  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.1976  7.89956  5.57291  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 606 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.3098  7.89956  5.57291  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.9933  7.89956  5.57291  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.0137  7.903  5.57456  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.0137  7.903  5.57456  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.0051  7.903  5.57456  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 600 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.0141  7.903  5.57456  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.9956  7.87978  5.5655  0.55
protocols.relax.FastRelax: {0} MRP: 2  -20.9956  -20.9956  7.87978  5.5655
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.9956  7.87978  5.5655  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.9956  7.87978  5.5655  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.9956  7.87978  5.5655  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.677  7.87978  5.5655  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5282  7.87978  5.5655  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.3406  7.87978  5.5655  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.419  7.8759  5.56551  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.419  7.8759  5.56551  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7346  7.8759  5.56551  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 616 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.9497  7.8759  5.56551  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7247  7.8759  5.56551  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.7522  7.8781  5.56796  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.7522  7.8781  5.56796  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.5624  7.8781  5.56796  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.6684  7.8781  5.56796  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.3487  7.8781  5.56796  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.3582  7.88005  5.56866  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.3582  7.88005  5.56866  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.2772  7.88005  5.56866  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 603 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.2772  7.88005  5.56866  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.9971  7.8738  5.56172  0.55
protocols.relax.FastRelax: {0} MRP: 3  -20.9971  -20.9971  7.8738  5.56172
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.9971  7.8738  5.56172  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.9971  7.8738  5.56172  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.9971  7.8738  5.56172  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.6768  7.8738  5.56172  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5431  7.8738  5.56172  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.3549  7.8738  5.56172  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.4329  7.86995  5.56174  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.4329  7.86995  5.56174  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7356  7.86995  5.56174  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 617 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.9524  7.86995  5.56174  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7267  7.86995  5.56174  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.7543  7.87218  5.56421  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.7543  7.87218  5.56421  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.5528  7.87218  5.56421  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.6509  7.87218  5.56421  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.3299  7.87218  5.56421  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.3393  7.87407  5.56487  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.3393  7.87407  5.56487  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.2317  7.87407  5.56487  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 603 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.2317  7.87407  5.56487  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.9975  7.87271  5.56047  0.55
protocols.relax.FastRelax: {0} MRP: 4  -20.9975  -20.9975  7.87271  5.56047
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.9975  7.87271  5.56047  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.9975  7.87271  5.56047  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_32.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14689.4  9.28722  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14689.4  9.28722  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1884.93  9.28722  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 598 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  81.0898  9.28722  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  84.4292  9.28722  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -6.69357  12.5425  14.0203  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -6.69357  12.5425  14.0203  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  9.96978  12.5425  14.0203  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 647 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  5.33685  12.5425  14.0203  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6.47338  12.5425  14.0203  0.154
protocols.relax.FastRelax: {0} CMD: min  -6.462  12.9971  15.2079  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -6.462  12.9971  15.2079  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.33945  12.9971  15.2079  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 674 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  1.86428  12.9971  15.2079  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.55041  12.9971  15.2079  0.31955
protocols.relax.FastRelax: {0} CMD: min  -4.204  13.928  16.9706  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.204  13.928  16.9706  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.33574  13.928  16.9706  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 657 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  4.21539  13.928  16.9706  0.55
protocols.relax.FastRelax: {0} CMD: min  -2.52662  13.852  17.3413  0.55
protocols.relax.FastRelax: {0} MRP: 0  -2.52662  -2.52662  13.852  17.3413
protocols.relax.FastRelax: {0} CMD: accept_to_best  -2.52662  13.852  17.3413  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -2.52662  13.852  17.3413  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -2.52662  13.852  17.3413  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.5204  13.852  17.3413  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 681 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7089  13.852  17.3413  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.5249  13.852  17.3413  0.02805
protocols.relax.FastRelax: {0} CMD: min  -16.5646  13.8496  17.3391  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.5646  13.8496  17.3391  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.9703  13.8496  17.3391  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.9704  13.8496  17.3391  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.7184  13.8496  17.3391  0.154
protocols.relax.FastRelax: {0} CMD: min  -12.733  13.8483  17.338  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.733  13.8483  17.338  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.03799  13.8483  17.338  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 674 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.08631  13.8483  17.338  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.74141  13.8483  17.338  0.31955
protocols.relax.FastRelax: {0} CMD: min  -7.74546  13.8481  17.338  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -7.74546  13.8481  17.338  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.17346  13.8481  17.338  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.17348  13.8481  17.338  0.55
protocols.relax.FastRelax: {0} CMD: min  -4.77886  13.9664  17.6649  0.55
protocols.relax.FastRelax: {0} MRP: 1  -4.77886  -4.77886  13.9664  17.6649
protocols.relax.FastRelax: {0} CMD: accept_to_best  -4.77886  13.9664  17.6649  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -4.77886  13.9664  17.6649  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.77886  13.9664  17.6649  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.0778  13.9664  17.6649  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 663 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.835  13.9664  17.6649  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5648  13.9664  17.6649  0.02805
protocols.relax.FastRelax: {0} CMD: min  -20.6087  13.964  17.6629  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.6087  13.964  17.6629  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.34  13.964  17.6629  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.3403  13.964  17.6629  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.971  13.964  17.6629  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.0764  13.9621  17.661  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.0764  13.9621  17.661  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.30242  13.9621  17.661  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 655 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.3219  13.9621  17.661  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.95046  13.9621  17.661  0.31955
protocols.relax.FastRelax: {0} CMD: min  -9.96259  13.9619  17.661  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.96259  13.9619  17.661  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -2.88931  13.9619  17.661  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 652 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.88931  13.9619  17.661  0.55
protocols.relax.FastRelax: {0} CMD: min  -5.56727  13.9698  17.6769  0.55
protocols.relax.FastRelax: {0} MRP: 2  -5.56727  -5.56727  13.9698  17.6769
protocols.relax.FastRelax: {0} CMD: accept_to_best  -5.56727  13.9698  17.6769  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -5.56727  13.9698  17.6769  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -5.56727  13.9698  17.6769  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.2054  13.9698  17.6769  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 664 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.7845  13.9698  17.6769  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5001  13.9698  17.6769  0.02805
protocols.relax.FastRelax: {0} CMD: min  -20.5408  13.9675  17.6748  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.5408  13.9675  17.6748  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.0112  13.9675  17.6748  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.0113  13.9675  17.6748  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.6237  13.9675  17.6748  0.154
protocols.relax.FastRelax: {0} CMD: min  -17.1092  14.1128  17.8481  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.1092  14.1128  17.8481  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.755  14.1128  17.8481  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.0887  14.1128  17.8481  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.6273  14.1128  17.8481  0.31955
protocols.relax.FastRelax: {0} CMD: min  -10.6702  14.1077  17.8417  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.6702  14.1077  17.8417  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.89232  14.1077  17.8417  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.89278  14.1077  17.8417  0.55
protocols.relax.FastRelax: {0} CMD: min  -6.93008  13.9648  17.6699  0.55
protocols.relax.FastRelax: {0} MRP: 3  -6.93008  -6.93008  13.9648  17.6699
protocols.relax.FastRelax: {0} CMD: accept_to_best  -6.93008  13.9648  17.6699  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -6.93008  13.9648  17.6699  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -6.93008  13.9648  17.6699  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.8875  13.9648  17.6699  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 683 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.3968  13.9648  17.6699  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.2212  13.9648  17.6699  0.02805
protocols.relax.FastRelax: {0} CMD: min  -21.269  13.9627  17.6681  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.269  13.9627  17.6681  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.8404  13.9627  17.6681  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.8404  13.9627  17.6681  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.6001  13.9627  17.6681  0.154
protocols.relax.FastRelax: {0} CMD: min  -17.6248  13.9615  17.6671  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6248  13.9615  17.6671  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.1441  13.9615  17.6671  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 674 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.1441  13.9615  17.6671  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.7907  13.9615  17.6671  0.31955
protocols.relax.FastRelax: {0} CMD: min  -12.7978  13.9613  17.6669  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.7978  13.9613  17.6669  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.06131  13.9613  17.6669  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 671 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -6.06132  13.9613  17.6669  0.55
protocols.relax.FastRelax: {0} CMD: min  -6.93399  13.9711  17.6786  0.55
protocols.relax.FastRelax: {0} MRP: 4  -6.93399  -6.93399  13.9711  17.6786
protocols.relax.FastRelax: {0} CMD: accept_to_best  -6.93399  13.9711  17.6786  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -6.93399  13.9711  17.6786  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_49.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14847.9  9.21942  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14847.9  9.21942  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1840.27  9.21942  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 556 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  90.1026  9.21942  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  97.3927  9.21942  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -14.0342  8.72855  2.39944  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.0342  8.72855  2.39944  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.0561673  8.72855  2.39944  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 615 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.45291  8.72855  2.39944  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.61816  8.72855  2.39944  0.154
protocols.relax.FastRelax: {0} CMD: min  -22.3803  8.81978  2.96907  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.3803  8.81978  2.96907  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.6646  8.81978  2.96907  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 603 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.9634  8.81978  2.96907  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.4335  8.81978  2.96907  0.31955
protocols.relax.FastRelax: {0} CMD: min  -15.5581  8.81146  2.97573  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.5581  8.81146  2.97573  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -5.62291  8.81146  2.97573  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 591 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -5.69457  8.81146  2.97573  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.8545  9.01636  4.10729  0.55
protocols.relax.FastRelax: {0} MRP: 0  -19.8545  -19.8545  9.01636  4.10729
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.8545  9.01636  4.10729  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.8545  9.01636  4.10729  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.8545  9.01636  4.10729  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.0596  9.01636  4.10729  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 708 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.1305  9.01636  4.10729  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.9176  9.01636  4.10729  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.0371  9.02057  4.10437  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.0371  9.02057  4.10437  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.8584  9.02057  4.10437  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.7016  9.02057  4.10437  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.4783  9.02057  4.10437  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.5009  9.02091  4.10432  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.5009  9.02091  4.10432  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.3313  9.02091  4.10432  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 622 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.3313  9.02091  4.10432  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.0025  9.02091  4.10432  0.31955
protocols.relax.FastRelax: {0} CMD: min  -27.0153  9.01863  4.10623  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.0153  9.01863  4.10623  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7692  9.01863  4.10623  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 613 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.7692  9.01863  4.10623  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.2705  9.253  4.31543  0.55
protocols.relax.FastRelax: {0} MRP: 1  -22.2705  -22.2705  9.253  4.31543
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.2705  9.253  4.31543  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.2705  9.253  4.31543  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.2705  9.253  4.31543  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.539  9.253  4.31543  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.0126  9.253  4.31543  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.8001  9.253  4.31543  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.9198  9.25655  4.31158  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.9198  9.25655  4.31158  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7496  9.25655  4.31158  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.6099  9.25655  4.31158  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.389  9.25655  4.31158  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.4117  9.25677  4.31109  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.4117  9.25677  4.31109  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2857  9.25677  4.31109  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.2857  9.25677  4.31109  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.9604  9.25677  4.31109  0.31955
protocols.relax.FastRelax: {0} CMD: min  -27.973  9.25476  4.31296  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.973  9.25476  4.31296  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.7926  9.25476  4.31296  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.7926  9.25476  4.31296  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.2633  9.2561  4.33891  0.55
protocols.relax.FastRelax: {0} MRP: 2  -22.2633  -22.2705  9.253  4.31543
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.2633  9.2561  4.33891  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.2633  9.2561  4.33891  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.2633  9.2561  4.33891  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5251  9.2561  4.33891  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.0089  9.2561  4.33891  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.7965  9.2561  4.33891  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.9158  9.25963  4.33504  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.9158  9.25963  4.33504  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7469  9.25963  4.33504  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.6042  9.25963  4.33504  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.3829  9.25963  4.33504  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.4055  9.25982  4.33458  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.4055  9.25982  4.33458  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2728  9.25982  4.33458  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.2729  9.25982  4.33458  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.947  9.25982  4.33458  0.31955
protocols.relax.FastRelax: {0} CMD: min  -27.9601  9.2578  4.33649  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.9601  9.2578  4.33649  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.7701  9.2578  4.33649  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.7701  9.2578  4.33649  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.2652  9.25675  4.34837  0.55
protocols.relax.FastRelax: {0} MRP: 3  -22.2652  -22.2705  9.253  4.31543
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.2652  9.25675  4.34837  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.2652  9.25675  4.34837  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.2652  9.25675  4.34837  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5269  9.25675  4.34837  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.0072  9.25675  4.34837  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.7948  9.25675  4.34837  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.9135  9.26027  4.34447  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.9135  9.26027  4.34447  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7457  9.26027  4.34447  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.6038  9.26027  4.34447  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.3827  9.26027  4.34447  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.4051  9.26047  4.34398  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.4051  9.26047  4.34398  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.2767  9.26047  4.34398  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.2767  9.26047  4.34398  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.9512  9.26047  4.34398  0.31955
protocols.relax.FastRelax: {0} CMD: min  -27.9643  9.25845  4.34588  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.9643  9.25845  4.34588  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.781  9.25845  4.34588  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.781  9.25845  4.34588  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.265  9.25639  4.34573  0.55
protocols.relax.FastRelax: {0} MRP: 4  -22.265  -22.2705  9.253  4.31543
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.265  9.25639  4.34573  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.265  9.25639  4.34573  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_5.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14367.1  8.59706  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14367.1  8.59706  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1865.63  8.59706  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  54.9894  8.59706  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  58.7697  8.59706  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  58.6866  8.5993  0.0117046  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  58.6866  8.5993  0.0117046  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  131.97  8.5993  0.0117046  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 594 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  122.819  8.5993  0.0117046  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  127.135  8.5993  0.0117046  0.154
protocols.relax.FastRelax: {0} CMD: min  1327.52  9.01483  6.08874  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  1327.52  9.01483  6.08874  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2698.66  9.01483  6.08874  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 628 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  2101.85  9.01483  6.08874  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2186.41  9.01483  6.08874  0.31955
protocols.relax.FastRelax: {0} CMD: min  -8.19817  8.56185  4.85891  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.19817  8.56185  4.85891  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.485651  8.56185  4.85891  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 605 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.44525  8.56185  4.85891  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.6228  8.54259  5.04597  0.55
protocols.relax.FastRelax: {0} MRP: 0  -28.6228  -28.6228  8.54259  5.04597
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.6228  8.54259  5.04597  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.6228  8.54259  5.04597  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.6228  8.54259  5.04597  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.8525  8.54259  5.04597  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.079  8.54259  5.04597  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.8814  8.54259  5.04597  0.02805
protocols.relax.FastRelax: {0} CMD: min  -42.6708  8.57711  5.0373  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.6708  8.57711  5.0373  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.9197  8.57711  5.0373  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 603 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.5691  8.57711  5.0373  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.1637  8.57711  5.0373  0.154
protocols.relax.FastRelax: {0} CMD: min  -36.5432  8.5627  5.04928  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.5432  8.5627  5.04928  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.4174  8.5627  5.04928  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.0442  8.5627  5.04928  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.6818  8.5627  5.04928  0.31955
protocols.relax.FastRelax: {0} CMD: min  -32.9582  8.55471  5.0457  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.9582  8.55471  5.0457  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.4024  8.55471  5.0457  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 591 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.6154  8.55471  5.0457  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.3157  8.653  4.88913  0.55
protocols.relax.FastRelax: {0} MRP: 1  -30.3157  -30.3157  8.653  4.88913
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.3157  8.653  4.88913  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.3157  8.653  4.88913  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3157  8.653  4.88913  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.6708  8.653  4.88913  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.8865  8.653  4.88913  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.7239  8.653  4.88913  0.02805
protocols.relax.FastRelax: {0} CMD: min  -49.0812  8.71871  4.62617  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.0812  8.71871  4.62617  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.1626  8.71871  4.62617  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 590 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.3107  8.71871  4.62617  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.2032  8.71871  4.62617  0.154
protocols.relax.FastRelax: {0} CMD: min  -41.3938  8.78026  4.69074  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.3938  8.78026  4.69074  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5446  8.78026  4.69074  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 592 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5455  8.78026  4.69074  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.006  8.78026  4.69074  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.2299  8.77001  4.68113  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.2299  8.77001  4.68113  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.7784  8.77001  4.68113  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 580 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.8161  8.77001  4.68113  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.3177  8.65779  4.9068  0.55
protocols.relax.FastRelax: {0} MRP: 2  -30.3177  -30.3177  8.65779  4.9068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.3177  8.65779  4.9068  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.3177  8.65779  4.9068  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3177  8.65779  4.9068  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.65  8.65779  4.9068  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 609 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.0967  8.65779  4.9068  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.5619  8.65779  4.9068  0.02805
protocols.relax.FastRelax: {0} CMD: min  -51.2727  8.77662  4.68778  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -51.2727  8.77662  4.68778  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.5409  8.77662  4.68778  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 591 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.7696  8.77662  4.68778  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.9797  8.77662  4.68778  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.4277  8.80985  4.78132  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.4277  8.80985  4.78132  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.3694  8.80985  4.78132  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 593 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.4003  8.80985  4.78132  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.8445  8.80985  4.78132  0.31955
protocols.relax.FastRelax: {0} CMD: min  -33.2  8.79697  4.77767  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.2  8.79697  4.77767  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.3817  8.79697  4.77767  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 587 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.4651  8.79697  4.77767  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.3173  8.6539  4.90573  0.55
protocols.relax.FastRelax: {0} MRP: 3  -30.3173  -30.3177  8.65779  4.9068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.3173  8.6539  4.90573  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.3173  8.6539  4.90573  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3173  8.6539  4.90573  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.6446  8.6539  4.90573  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 609 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.869  8.6539  4.90573  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.7079  8.6539  4.90573  0.02805
protocols.relax.FastRelax: {0} CMD: min  -47.9125  8.64214  4.74776  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.9125  8.64214  4.74776  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.8744  8.64214  4.74776  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 594 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.3715  8.64214  4.74776  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4289  8.64214  4.74776  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.9878  8.72989  4.73807  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.9878  8.72989  4.73807  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5634  8.72989  4.73807  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 594 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5775  8.72989  4.73807  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.0716  8.72989  4.73807  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.3248  8.72128  4.72896  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.3248  8.72128  4.72896  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.409  8.72128  4.72896  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 582 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.5875  8.72128  4.72896  0.55
protocols.relax.FastRelax: {0} CMD: min  -30.2806  8.63286  4.84086  0.55
protocols.relax.FastRelax: {0} MRP: 4  -30.2806  -30.3177  8.65779  4.9068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -30.2806  8.63286  4.84086  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -30.2806  8.63286  4.84086  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_17.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13671.5  8.49434  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13671.5  8.49434  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1892.04  8.49434  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 558 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  68.4432  8.49434  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  71.5877  8.49434  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -4.31223  10.2456  8.8241  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.31223  10.2456  8.8241  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  49.7982  10.2456  8.8241  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  24.4782  10.2456  8.8241  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  26.8922  10.2456  8.8241  0.154
protocols.relax.FastRelax: {0} CMD: min  -14.2654  10.6429  8.41312  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.2654  10.6429  8.41312  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.83687  10.6429  8.41312  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 615 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.03805  10.6429  8.41312  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.61028  10.6429  8.41312  0.31955
protocols.relax.FastRelax: {0} CMD: min  -8.66335  10.6429  8.4117  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.66335  10.6429  8.4117  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.559239  10.6429  8.4117  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.613099  10.6429  8.4117  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.6386  8.66366  8.36488  0.55
protocols.relax.FastRelax: {0} MRP: 0  -17.6386  -17.6386  8.66366  8.36488
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.6386  8.66366  8.36488  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.6386  8.66366  8.36488  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.6386  8.66366  8.36488  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.1802  8.66366  8.36488  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.327  8.66366  8.36488  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.1658  8.66366  8.36488  0.02805
protocols.relax.FastRelax: {0} CMD: min  -30.2679  8.66346  8.36858  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.2679  8.66346  8.36858  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.1104  8.66346  8.36858  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 585 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1105  8.66346  8.36858  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.8892  8.66346  8.36858  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.955  8.66291  8.37003  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.955  8.66291  8.37003  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.826  8.66291  8.37003  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 582 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.3224  8.66291  8.37003  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.0446  8.66291  8.37003  0.31955
protocols.relax.FastRelax: {0} CMD: min  -23.0601  8.66283  8.3718  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.0601  8.66283  8.3718  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.776  8.66283  8.3718  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 578 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.776  8.66283  8.3718  0.55
protocols.relax.FastRelax: {0} CMD: min  -26.7062  9.01324  10.4978  0.55
protocols.relax.FastRelax: {0} MRP: 1  -26.7062  -26.7062  9.01324  10.4978
protocols.relax.FastRelax: {0} CMD: accept_to_best  -26.7062  9.01324  10.4978  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -26.7062  9.01324  10.4978  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.7062  9.01324  10.4978  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.0299  9.01324  10.4978  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.0881  9.01324  10.4978  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.8999  9.01324  10.4978  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.0152  9.00128  10.6538  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.0152  9.00128  10.6538  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.707  9.00128  10.6538  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0532  9.00128  10.6538  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.4796  9.00128  10.6538  0.154
protocols.relax.FastRelax: {0} CMD: min  -31.3357  9.42688  11.0128  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.3357  9.42688  11.0128  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.425  9.42688  11.0128  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 587 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.6385  9.42688  11.0128  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2041  9.42688  11.0128  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.8409  9.41343  10.9885  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.8409  9.41343  10.9885  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.1736  9.41343  10.9885  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 581 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.1736  9.41343  10.9885  0.55
protocols.relax.FastRelax: {0} CMD: min  -24.4717  9.52658  10.6949  0.55
protocols.relax.FastRelax: {0} MRP: 2  -24.4717  -26.7062  9.01324  10.4978
protocols.relax.FastRelax: {0} CMD: accept_to_best  -24.4717  9.52658  10.6949  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -24.4717  9.52658  10.6949  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.4717  9.52658  10.6949  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.5071  9.52658  10.6949  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 616 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.939  9.52658  10.6949  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.246  9.52658  10.6949  0.02805
protocols.relax.FastRelax: {0} CMD: min  -45.317  9.38359  10.7374  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.317  9.38359  10.7374  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.443  9.38359  10.7374  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 609 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.2216  9.38359  10.7374  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.3597  9.38359  10.7374  0.154
protocols.relax.FastRelax: {0} CMD: min  -36.072  9.46652  10.7562  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.072  9.46652  10.7562  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.8778  9.46652  10.7562  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 600 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.9526  9.46652  10.7562  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.3851  9.46652  10.7562  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.068  9.52275  10.78  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.068  9.52275  10.78  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.0476  9.52275  10.78  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 594 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.3239  9.52275  10.78  0.55
protocols.relax.FastRelax: {0} CMD: min  -27.7682  9.78057  11.1577  0.55
protocols.relax.FastRelax: {0} MRP: 3  -27.7682  -27.7682  9.78057  11.1577
protocols.relax.FastRelax: {0} CMD: accept_to_best  -27.7682  9.78057  11.1577  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -27.7682  9.78057  11.1577  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.7682  9.78057  11.1577  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.5868  9.78057  11.1577  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 606 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.9643  9.78057  11.1577  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.8051  9.78057  11.1577  0.02805
protocols.relax.FastRelax: {0} CMD: min  -46.7423  9.77302  11.2259  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.7423  9.77302  11.2259  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.0889  9.77302  11.2259  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 603 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.614  9.77302  11.2259  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.9909  9.77302  11.2259  0.154
protocols.relax.FastRelax: {0} CMD: min  -36.2652  9.85397  11.3353  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.2652  9.85397  11.3353  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.6578  9.85397  11.3353  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 607 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.7885  9.85397  11.3353  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.2684  9.85397  11.3353  0.31955
protocols.relax.FastRelax: {0} CMD: min  -29.7503  9.85426  11.3244  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.7503  9.85426  11.3244  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5931  9.85426  11.3244  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.5965  9.85426  11.3244  0.55
protocols.relax.FastRelax: {0} CMD: min  -25.5776  9.85806  11.3001  0.55
protocols.relax.FastRelax: {0} MRP: 4  -25.5776  -27.7682  9.78057  11.1577
protocols.relax.FastRelax: {0} CMD: accept_to_best  -25.5776  9.85806  11.3001  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -25.5776  9.85806  11.3001  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_11.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15406.4  8.6875  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15406.4  8.6875  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1936.72  8.6875  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  155.149  8.6875  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  173.986  8.6875  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.5343  7.50217  7.80915  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.5343  7.50217  7.80915  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.8077  7.50217  7.80915  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.6356  7.50217  7.80915  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.431  7.50217  7.80915  0.154
protocols.relax.FastRelax: {0} CMD: min  -33.8171  7.58441  7.50346  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.8171  7.58441  7.50346  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.6332  7.58441  7.50346  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 708 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.9187  7.58441  7.50346  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.3621  7.58441  7.50346  0.31955
protocols.relax.FastRelax: {0} CMD: min  -26.6919  7.56495  7.48211  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.6919  7.56495  7.48211  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.4797  7.56495  7.48211  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 705 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.5204  7.56495  7.48211  0.55
protocols.relax.FastRelax: {0} CMD: min  -27.2534  7.94071  8.31759  0.55
protocols.relax.FastRelax: {0} MRP: 0  -27.2534  -27.2534  7.94071  8.31759
protocols.relax.FastRelax: {0} CMD: accept_to_best  -27.2534  7.94071  8.31759  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -27.2534  7.94071  8.31759  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.2534  7.94071  8.31759  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.1156  7.94071  8.31759  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 717 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -43.9389  7.94071  8.31759  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.7353  7.94071  8.31759  0.02805
protocols.relax.FastRelax: {0} CMD: min  -43.8535  7.94128  8.30977  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -43.8535  7.94128  8.30977  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.8335  7.94128  8.30977  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.0113  7.94128  8.30977  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.7414  7.94128  8.30977  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.7911  7.94314  8.30816  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.7911  7.94314  8.30816  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.7534  7.94314  8.30816  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 698 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.7534  7.94314  8.30816  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.3562  7.94314  8.30816  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.4182  7.94618  8.31419  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.4182  7.94618  8.31419  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9126  7.94618  8.31419  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 691 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.9126  7.94618  8.31419  0.55
protocols.relax.FastRelax: {0} CMD: min  -29.4588  8.18481  8.76009  0.55
protocols.relax.FastRelax: {0} MRP: 1  -29.4588  -29.4588  8.18481  8.76009
protocols.relax.FastRelax: {0} CMD: accept_to_best  -29.4588  8.18481  8.76009  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -29.4588  8.18481  8.76009  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.4588  8.18481  8.76009  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.3901  8.18481  8.76009  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 714 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -44.8408  8.18481  8.76009  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.6257  8.18481  8.76009  0.02805
protocols.relax.FastRelax: {0} CMD: min  -44.7513  8.1848  8.75136  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -44.7513  8.1848  8.75136  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.5194  8.1848  8.75136  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 699 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.575  8.1848  8.75136  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.302  8.1848  8.75136  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.3536  8.18665  8.74937  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.3536  8.18665  8.74937  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.2592  8.18665  8.74937  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 695 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.4471  8.18665  8.74937  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.054  8.18665  8.74937  0.31955
protocols.relax.FastRelax: {0} CMD: min  -35.1148  8.18968  8.75515  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.1148  8.18968  8.75515  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6861  8.18968  8.75515  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 688 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.3215  8.18968  8.75515  0.55
protocols.relax.FastRelax: {0} CMD: min  -29.7267  8.20119  8.74219  0.55
protocols.relax.FastRelax: {0} MRP: 2  -29.7267  -29.7267  8.20119  8.74219
protocols.relax.FastRelax: {0} CMD: accept_to_best  -29.7267  8.20119  8.74219  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -29.7267  8.20119  8.74219  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.7267  8.20119  8.74219  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.5183  8.20119  8.74219  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 714 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -45.1258  8.20119  8.74219  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.9207  8.20119  8.74219  0.02805
protocols.relax.FastRelax: {0} CMD: min  -45.0386  8.20122  8.7341  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.0386  8.20122  8.7341  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.9887  8.20122  8.7341  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 698 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.1714  8.20122  8.7341  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.8997  8.20122  8.7341  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.9489  8.20283  8.73227  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.9489  8.20283  8.73227  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.879  8.20283  8.73227  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 694 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.8958  8.20283  8.73227  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5039  8.20283  8.73227  0.31955
protocols.relax.FastRelax: {0} CMD: min  -35.5678  8.20595  8.73816  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.5678  8.20595  8.73816  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.1661  8.20595  8.73816  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 688 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.1661  8.20595  8.73816  0.55
protocols.relax.FastRelax: {0} CMD: min  -29.7271  8.20616  8.73454  0.55
protocols.relax.FastRelax: {0} MRP: 3  -29.7271  -29.7271  8.20616  8.73454
protocols.relax.FastRelax: {0} CMD: accept_to_best  -29.7271  8.20616  8.73454  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -29.7271  8.20616  8.73454  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.7271  8.20616  8.73454  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.5206  8.20616  8.73454  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 715 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -45.1371  8.20616  8.73454  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.9407  8.20616  8.73454  0.02805
protocols.relax.FastRelax: {0} CMD: min  -45.0669  8.20605  8.72586  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.0669  8.20605  8.72586  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.1971  8.20605  8.72586  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 700 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.1971  8.20605  8.72586  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.9258  8.20605  8.72586  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.9747  8.20766  8.72404  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.9747  8.20766  8.72404  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.9112  8.20766  8.72404  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 696 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.9242  8.20766  8.72404  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5327  8.20766  8.72404  0.31955
protocols.relax.FastRelax: {0} CMD: min  -35.5934  8.21076  8.72993  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.5934  8.21076  8.72993  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.1975  8.21076  8.72993  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 690 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.1975  8.21076  8.72993  0.55
protocols.relax.FastRelax: {0} CMD: min  -29.7267  8.20635  8.73151  0.55
protocols.relax.FastRelax: {0} MRP: 4  -29.7267  -29.7271  8.20616  8.73454
protocols.relax.FastRelax: {0} CMD: accept_to_best  -29.7267  8.20635  8.73151  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -29.7267  8.20635  8.73151  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_39.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15591.4  8.184  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15591.4  8.184  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2013.55  8.184  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  70.1105  8.184  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  77.4298  8.184  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  97.6707  8.82366  6.8651  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  97.6707  8.82366  6.8651  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  292.237  8.82366  6.8651  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  55.4851  8.82366  6.8651  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  56.1504  8.82366  6.8651  0.154
protocols.relax.FastRelax: {0} CMD: min  56.0614  8.8272  6.85414  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  56.0614  8.8272  6.85414  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  68.4155  8.8272  6.85414  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 590 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  68.1246  8.8272  6.85414  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  69.0554  8.8272  6.85414  0.31955
protocols.relax.FastRelax: {0} CMD: min  68.9159  8.82788  6.83933  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68.9159  8.82788  6.83933  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  86.5841  8.82788  6.83933  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 572 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  86.5835  8.82788  6.83933  0.55
protocols.relax.FastRelax: {0} CMD: min  -8.81212  9.48887  8.93843  0.55
protocols.relax.FastRelax: {0} MRP: 0  -8.81212  -8.81212  9.48887  8.93843
protocols.relax.FastRelax: {0} CMD: accept_to_best  -8.81212  9.48887  8.93843  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -8.81212  9.48887  8.93843  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.81212  9.48887  8.93843  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.4033  9.48887  8.93843  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 714 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.7873  9.48887  8.93843  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.5824  9.48887  8.93843  0.02805
protocols.relax.FastRelax: {0} CMD: min  -24.6052  9.49052  8.94034  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.6052  9.49052  8.94034  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.6202  9.49052  8.94034  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 711 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.9768  9.49052  8.94034  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7634  9.49052  8.94034  0.154
protocols.relax.FastRelax: {0} CMD: min  -20.7927  9.49429  8.94578  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.7927  9.49429  8.94578  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.8303  9.49429  8.94578  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 691 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.8304  9.49429  8.94578  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.5179  9.49429  8.94578  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.5604  9.5005  8.95553  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.5604  9.5005  8.95553  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.6271  9.5005  8.95553  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 687 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.6418  9.5005  8.95553  0.55
protocols.relax.FastRelax: {0} CMD: min  -13.994  9.92784  9.5497  0.55
protocols.relax.FastRelax: {0} MRP: 1  -13.994  -13.994  9.92784  9.5497
protocols.relax.FastRelax: {0} CMD: accept_to_best  -13.994  9.92784  9.5497  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -13.994  9.92784  9.5497  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.994  9.92784  9.5497  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.7452  9.92784  9.5497  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 733 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.5232  9.92784  9.5497  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.3069  9.92784  9.5497  0.02805
protocols.relax.FastRelax: {0} CMD: min  -27.3226  9.92383  9.54291  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.3226  9.92383  9.54291  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.1108  9.92383  9.54291  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 730 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.8985  9.92383  9.54291  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.689  9.92383  9.54291  0.154
protocols.relax.FastRelax: {0} CMD: min  -23.6977  9.92131  9.53847  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.6977  9.92131  9.53847  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.7965  9.92131  9.53847  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 710 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.7965  9.92131  9.53847  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4889  9.92131  9.53847  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.4923  9.92044  9.53692  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.4923  9.92044  9.53692  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.6321  9.92044  9.53692  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 705 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.6723  9.92044  9.53692  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.8638  10.1565  9.93186  0.55
protocols.relax.FastRelax: {0} MRP: 2  -14.8638  -14.8638  10.1565  9.93186
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.8638  10.1565  9.93186  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.8638  10.1565  9.93186  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.8638  10.1565  9.93186  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6088  10.1565  9.93186  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 735 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.9908  10.1565  9.93186  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.7215  10.1565  9.93186  0.02805
protocols.relax.FastRelax: {0} CMD: min  -27.7395  10.1519  9.92439  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.7395  10.1519  9.92439  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.5024  10.1519  9.92439  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 732 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.609  10.1519  9.92439  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.4037  10.1519  9.92439  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.413  10.1488  9.91921  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.413  10.1488  9.91921  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5912  10.1488  9.91921  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 711 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.5912  10.1488  9.91921  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.2898  10.1488  9.91921  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.2933  10.1476  9.91702  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.2933  10.1476  9.91702  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.552  10.1476  9.91702  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 704 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.5521  10.1476  9.91702  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.8646  10.1459  9.91098  0.55
protocols.relax.FastRelax: {0} MRP: 3  -14.8646  -14.8646  10.1459  9.91098
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.8646  10.1459  9.91098  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.8646  10.1459  9.91098  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.8646  10.1459  9.91098  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6115  10.1459  9.91098  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 735 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.9892  10.1459  9.91098  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.7223  10.1459  9.91098  0.02805
protocols.relax.FastRelax: {0} CMD: min  -27.7402  10.1413  9.90354  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.7402  10.1413  9.90354  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.5483  10.1413  9.90354  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 732 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.6034  10.1413  9.90354  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3984  10.1413  9.90354  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.4076  10.1383  9.89838  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.4076  10.1383  9.89838  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5901  10.1383  9.89838  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 711 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.5901  10.1383  9.89838  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.2891  10.1383  9.89838  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.2925  10.137  9.89621  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.2925  10.137  9.89621  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.5577  10.137  9.89621  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 704 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.5578  10.137  9.89621  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.865  10.1511  9.91255  0.55
protocols.relax.FastRelax: {0} MRP: 4  -14.865  -14.865  10.1511  9.91255
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.865  10.1511  9.91255  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.865  10.1511  9.91255  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_1.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16293.6  6.92407  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16293.6  6.92407  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2182.95  6.92407  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  146.028  6.92407  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  164.953  6.92407  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -32.3553  7.02407  2.95046  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.3553  7.02407  2.95046  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.5553  7.02407  2.95046  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 645 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.4463  7.02407  2.95046  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.007  7.02407  2.95046  0.154
protocols.relax.FastRelax: {0} CMD: min  -29.1894  7.64723  3.47787  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.1894  7.64723  3.47787  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.5722  7.64723  3.47787  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8028  7.64723  3.47787  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.0103  7.64723  3.47787  0.31955
protocols.relax.FastRelax: {0} CMD: min  -22.0721  7.73755  3.48016  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.0721  7.73755  3.48016  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.312  7.73755  3.48016  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.3599  7.73755  3.48016  0.55
protocols.relax.FastRelax: {0} CMD: min  -9.02288  9.06884  5.16064  0.55
protocols.relax.FastRelax: {0} MRP: 0  -9.02288  -9.02288  9.06884  5.16064
protocols.relax.FastRelax: {0} CMD: accept_to_best  -9.02288  9.06884  5.16064  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -9.02288  9.06884  5.16064  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.02288  9.06884  5.16064  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.2027  9.06884  5.16064  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 709 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -45.3243  9.06884  5.16064  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.8655  9.06884  5.16064  0.02805
protocols.relax.FastRelax: {0} CMD: min  -55.7184  9.13782  5.49754  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -55.7184  9.13782  5.49754  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4128  9.13782  5.49754  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 686 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.2055  9.13782  5.49754  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.7893  9.13782  5.49754  0.154
protocols.relax.FastRelax: {0} CMD: min  -42.3673  9.15651  5.47679  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.3673  9.15651  5.47679  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.7146  9.15651  5.47679  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.7663  9.15651  5.47679  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.0045  9.15651  5.47679  0.31955
protocols.relax.FastRelax: {0} CMD: min  -32.745  9.14343  5.45603  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.745  9.14343  5.45603  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.506  9.14343  5.45603  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 623 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.513  9.14343  5.45603  0.55
protocols.relax.FastRelax: {0} CMD: min  -28.2195  9.34612  5.63452  0.55
protocols.relax.FastRelax: {0} MRP: 1  -28.2195  -28.2195  9.34612  5.63452
protocols.relax.FastRelax: {0} CMD: accept_to_best  -28.2195  9.34612  5.63452  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -28.2195  9.34612  5.63452  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -28.2195  9.34612  5.63452  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.9489  9.34612  5.63452  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 719 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.8714  9.34612  5.63452  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.3616  9.34612  5.63452  0.02805
protocols.relax.FastRelax: {0} CMD: min  -55.1173  9.4  5.77766  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -55.1173  9.4  5.77766  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.8657  9.4  5.77766  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 688 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.1516  9.4  5.77766  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9398  9.4  5.77766  0.154
protocols.relax.FastRelax: {0} CMD: min  -41.4955  9.34783  5.67657  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.4955  9.34783  5.67657  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7451  9.34783  5.67657  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.7078  9.34783  5.67657  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.8707  9.34783  5.67657  0.31955
protocols.relax.FastRelax: {0} CMD: min  -36.2883  9.35144  5.66483  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.2883  9.35144  5.66483  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2582  9.35144  5.66483  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.2583  9.35144  5.66483  0.55
protocols.relax.FastRelax: {0} CMD: min  -31.0858  9.26955  5.67528  0.55
protocols.relax.FastRelax: {0} MRP: 2  -31.0858  -31.0858  9.26955  5.67528
protocols.relax.FastRelax: {0} CMD: accept_to_best  -31.0858  9.26955  5.67528  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -31.0858  9.26955  5.67528  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.0858  9.26955  5.67528  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.8471  9.26955  5.67528  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 777 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -52.7702  9.26955  5.67528  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.256  9.26955  5.67528  0.02805
protocols.relax.FastRelax: {0} CMD: min  -60.3313  9.31984  5.8386  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -60.3313  9.31984  5.8386  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.2783  9.31984  5.8386  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 765 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -38.5524  9.31984  5.8386  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.2338  9.31984  5.8386  0.154
protocols.relax.FastRelax: {0} CMD: min  -45.5637  9.30283  5.73893  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.5637  9.30283  5.73893  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.0572  9.30283  5.73893  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 697 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.5371  9.30283  5.73893  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.7034  9.30283  5.73893  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.7788  9.31181  5.75404  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.7788  9.31181  5.75404  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.0781  9.31181  5.75404  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.0783  9.31181  5.75404  0.55
protocols.relax.FastRelax: {0} CMD: min  -31.4073  9.26608  5.66635  0.55
protocols.relax.FastRelax: {0} MRP: 3  -31.4073  -31.4073  9.26608  5.66635
protocols.relax.FastRelax: {0} CMD: accept_to_best  -31.4073  9.26608  5.66635  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -31.4073  9.26608  5.66635  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.4073  9.26608  5.66635  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -51.2383  9.26608  5.66635  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 782 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -53.1109  9.26608  5.66635  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -52.5987  9.26608  5.66635  0.02805
protocols.relax.FastRelax: {0} CMD: min  -62.34  9.32757  5.88854  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -62.34  9.32757  5.88854  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.9808  9.32757  5.88854  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 753 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.896  9.32757  5.88854  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.0267  9.32757  5.88854  0.154
protocols.relax.FastRelax: {0} CMD: min  -46.7934  9.3348  5.79036  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -46.7934  9.3348  5.79036  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.1541  9.3348  5.79036  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 684 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.4066  9.3348  5.79036  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.5523  9.3348  5.79036  0.31955
protocols.relax.FastRelax: {0} CMD: min  -38.7095  9.33594  5.7783  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.7095  9.33594  5.7783  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.5542  9.33594  5.7783  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.845  9.33594  5.7783  0.55
protocols.relax.FastRelax: {0} CMD: min  -31.402  9.27366  5.67789  0.55
protocols.relax.FastRelax: {0} MRP: 4  -31.402  -31.4073  9.26608  5.66635
protocols.relax.FastRelax: {0} CMD: accept_to_best  -31.402  9.27366  5.67789  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -31.402  9.27366  5.67789  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_33.pdb
protocols.relax.FastRelax: {0} CMD: repeat  13447.9  9.06459  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  13447.9  9.06459  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1753.16  9.06459  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  110.697  9.06459  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  119.922  9.06459  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -11.5485  15.1434  17.2329  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.5485  15.1434  17.2329  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.60929  15.1434  17.2329  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  0.58772  15.1434  17.2329  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.50455  15.1434  17.2329  0.154
protocols.relax.FastRelax: {0} CMD: min  -17.2519  16.8151  20.2299  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.2519  16.8151  20.2299  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.62387  16.8151  20.2299  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.99918  16.8151  20.2299  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.31081  16.8151  20.2299  0.31955
protocols.relax.FastRelax: {0} CMD: min  -8.35005  16.8168  20.2322  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.35005  16.8168  20.2322  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  4.69966  16.8168  20.2322  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  4.42835  16.8168  20.2322  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.1206  19.495  23.841  0.55
protocols.relax.FastRelax: {0} MRP: 0  -10.1206  -10.1206  19.495  23.841
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.1206  19.495  23.841  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.1206  19.495  23.841  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.1206  19.495  23.841  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2051  19.495  23.841  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 667 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.6535  19.495  23.841  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.0877  19.495  23.841  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.1098  19.4938  23.8396  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.1098  19.4938  23.8396  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.1302  19.4938  23.8396  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 646 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9299  19.4938  23.8396  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.6308  19.4938  23.8396  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.6374  19.4928  23.8385  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.6374  19.4928  23.8385  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.0699  19.4928  23.8385  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.07  19.4928  23.8385  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.631  19.4928  23.8385  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.6352  19.4927  23.8384  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.6352  19.4927  23.8384  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.277  19.4927  23.8384  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.277  19.4927  23.8384  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.8725  18.4163  22.5062  0.55
protocols.relax.FastRelax: {0} MRP: 1  -14.8725  -14.8725  18.4163  22.5062
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.8725  18.4163  22.5062  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.8725  18.4163  22.5062  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.8725  18.4163  22.5062  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.5361  18.4163  22.5062  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.2707  18.4163  22.5062  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.7227  18.4163  22.5062  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.7446  18.4152  22.5048  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.7446  18.4152  22.5048  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1132  18.4152  22.5048  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 642 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.102  18.4152  22.5048  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.8216  18.4152  22.5048  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.8277  18.4144  22.5039  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.8277  18.4144  22.5039  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.6089  18.4144  22.5039  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 638 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.609  18.4144  22.5039  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1975  18.4144  22.5039  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.2012  18.4144  22.504  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2012  18.4144  22.504  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.3664  18.4144  22.504  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.3664  18.4144  22.504  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.8773  18.4773  22.5984  0.55
protocols.relax.FastRelax: {0} MRP: 2  -14.8773  -14.8773  18.4773  22.5984
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.8773  18.4773  22.5984  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.8773  18.4773  22.5984  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.8773  18.4773  22.5984  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.5523  18.4773  22.5984  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.2251  18.4773  22.5984  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.6817  18.4773  22.5984  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.7034  18.4761  22.597  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.7034  18.4761  22.597  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1608  18.4761  22.597  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1069  18.4761  22.597  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.8278  18.4761  22.597  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.8339  18.4753  22.5961  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.8339  18.4753  22.5961  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.6383  18.4753  22.5961  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.6384  18.4753  22.5961  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.2287  18.4753  22.5961  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.2323  18.4752  22.5961  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2323  18.4752  22.5961  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.4322  18.4752  22.5961  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 631 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.4322  18.4752  22.5961  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.8823  18.4633  22.5845  0.55
protocols.relax.FastRelax: {0} MRP: 3  -14.8823  -14.8823  18.4633  22.5845
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.8823  18.4633  22.5845  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.8823  18.4633  22.5845  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.8823  18.4633  22.5845  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.5359  18.4633  22.5845  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.1616  18.4633  22.5845  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.6185  18.4633  22.5845  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.6405  18.4622  22.5831  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.6405  18.4622  22.5831  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1052  18.4622  22.5831  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 641 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.096  18.4622  22.5831  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.8169  18.4622  22.5831  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.823  18.4614  22.5822  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.823  18.4614  22.5822  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.6273  18.4614  22.5822  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 637 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.6274  18.4614  22.5822  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.2177  18.4614  22.5822  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.2214  18.4613  22.5823  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.2214  18.4613  22.5823  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.4211  18.4613  22.5823  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.4212  18.4613  22.5823  0.55
protocols.relax.FastRelax: {0} CMD: min  -14.8805  18.49  22.6209  0.55
protocols.relax.FastRelax: {0} MRP: 4  -14.8805  -14.8823  18.4633  22.5845
protocols.relax.FastRelax: {0} CMD: accept_to_best  -14.8805  18.49  22.6209  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -14.8805  18.49  22.6209  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_13.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16880.1  8.00504  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16880.1  8.00504  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1940.19  8.00504  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 602 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  54.2016  8.00504  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  56.9838  8.00504  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  56.8469  8.00682  0.00626248  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  56.8469  8.00682  0.00626248  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  110.431  8.00682  0.00626248  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 571 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  102.151  8.00682  0.00626248  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  105.229  8.00682  0.00626248  0.154
protocols.relax.FastRelax: {0} CMD: min  -16.0475  8.52589  3.96488  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.0475  8.52589  3.96488  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.65459  8.52589  3.96488  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 587 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.8801  8.52589  3.96488  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.3203  8.52589  3.96488  0.31955
protocols.relax.FastRelax: {0} CMD: min  -11.3467  8.52681  3.96546  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.3467  8.52681  3.96546  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -0.716613  8.52681  3.96546  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 578 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -0.716614  8.52681  3.96546  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.6471  8.09853  5.68962  0.55
protocols.relax.FastRelax: {0} MRP: 0  -16.6471  -16.6471  8.09853  5.68962
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.6471  8.09853  5.68962  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.6471  8.09853  5.68962  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6471  8.09853  5.68962  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.4555  8.09853  5.68962  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.9693  8.09853  5.68962  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.6033  8.09853  5.68962  0.02805
protocols.relax.FastRelax: {0} CMD: min  -29.658  8.10046  5.69172  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.658  8.10046  5.69172  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.6311  8.10046  5.69172  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0423  8.10046  5.69172  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7914  8.10046  5.69172  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.808  8.10031  5.69402  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.808  8.10031  5.69402  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1376  8.10031  5.69402  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 589 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.1376  8.10031  5.69402  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7693  8.10031  5.69402  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.786  8.10077  5.6958  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.786  8.10077  5.6958  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.7785  8.10077  5.6958  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 581 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.7785  8.10077  5.6958  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.6642  8.10661  5.62588  0.55
protocols.relax.FastRelax: {0} MRP: 1  -16.6642  -16.6642  8.10661  5.62588
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.6642  8.10661  5.62588  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.6642  8.10661  5.62588  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6642  8.10661  5.62588  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.508  8.10661  5.62588  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 627 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.0144  8.10661  5.62588  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.2248  8.10661  5.62588  0.02805
protocols.relax.FastRelax: {0} CMD: min  -29.284  8.10838  5.62762  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.284  8.10838  5.62762  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.0255  8.10838  5.62762  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 597 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0365  8.10838  5.62762  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7848  8.10838  5.62762  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.8013  8.10807  5.62994  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.8013  8.10807  5.62994  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1159  8.10807  5.62994  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 590 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.1159  8.10807  5.62994  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7464  8.10807  5.62994  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.7636  8.10839  5.63178  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.7636  8.10839  5.63178  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.7346  8.10839  5.63178  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 582 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.7346  8.10839  5.63178  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.6686  8.10475  5.59615  0.55
protocols.relax.FastRelax: {0} MRP: 2  -16.6686  -16.6686  8.10475  5.59615
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.6686  8.10475  5.59615  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.6686  8.10475  5.59615  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6686  8.10475  5.59615  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.4927  8.10475  5.59615  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.0435  8.10475  5.59615  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.2617  8.10475  5.59615  0.02805
protocols.relax.FastRelax: {0} CMD: min  -29.3205  8.10645  5.59788  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.3205  8.10645  5.59788  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.2099  8.10645  5.59788  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0246  8.10645  5.59788  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7728  8.10645  5.59788  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.7894  8.10612  5.60017  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7894  8.10612  5.60017  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.1014  8.10612  5.60017  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 589 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.1014  8.10612  5.60017  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.7317  8.10612  5.60017  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.7492  8.10643  5.602  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.7492  8.10643  5.602  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.7164  8.10643  5.602  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 582 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.7164  8.10643  5.602  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.6702  8.10513  5.58204  0.55
protocols.relax.FastRelax: {0} MRP: 3  -16.6702  -16.6702  8.10513  5.58204
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.6702  8.10513  5.58204  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.6702  8.10513  5.58204  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.6702  8.10513  5.58204  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.4949  8.10513  5.58204  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 626 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.0482  8.10513  5.58204  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.2683  8.10513  5.58204  0.02805
protocols.relax.FastRelax: {0} CMD: min  -29.3263  8.10676  5.58375  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.3263  8.10676  5.58375  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.2484  8.10676  5.58375  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 596 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.0204  8.10676  5.58375  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.7682  8.10676  5.58375  0.154
protocols.relax.FastRelax: {0} CMD: min  -25.7848  8.10642  5.58604  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7848  8.10642  5.58604  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.0911  8.10642  5.58604  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 589 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.0911  8.10642  5.58604  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.721  8.10642  5.58604  0.31955
protocols.relax.FastRelax: {0} CMD: min  -20.7388  8.10673  5.58788  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.7388  8.10673  5.58788  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -13.6975  8.10673  5.58788  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 581 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.6975  8.10673  5.58788  0.55
protocols.relax.FastRelax: {0} CMD: min  -16.6708  8.10446  5.56659  0.55
protocols.relax.FastRelax: {0} MRP: 4  -16.6708  -16.6708  8.10446  5.56659
protocols.relax.FastRelax: {0} CMD: accept_to_best  -16.6708  8.10446  5.56659  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -16.6708  8.10446  5.56659  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_2.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16092.5  8.22357  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16092.5  8.22357  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1980.08  8.22357  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 613 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  50.2907  8.22357  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  51.3311  8.22357  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  31.4033  8.5103  2.36226  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  31.4033  8.5103  2.36226  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  68.9983  8.5103  2.36226  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 594 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  39.1862  8.5103  2.36226  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  39.8996  8.5103  2.36226  0.154
protocols.relax.FastRelax: {0} CMD: min  39.69  8.51492  2.36227  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  39.69  8.51492  2.36227  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  52.92  8.51492  2.36227  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 586 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  52.7418  8.51492  2.36227  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  53.7607  8.51492  2.36227  0.31955
protocols.relax.FastRelax: {0} CMD: min  -15.0338  8.95205  6.14432  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.0338  8.95205  6.14432  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.62245  8.95205  6.14432  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 606 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.8522  8.95205  6.14432  0.55
protocols.relax.FastRelax: {0} CMD: min  -24.8356  9.03433  4.36158  0.55
protocols.relax.FastRelax: {0} MRP: 0  -24.8356  -24.8356  9.03433  4.36158
protocols.relax.FastRelax: {0} CMD: accept_to_best  -24.8356  9.03433  4.36158  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -24.8356  9.03433  4.36158  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.8356  9.03433  4.36158  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -37.2422  9.03433  4.36158  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 702 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.8018  9.03433  4.36158  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.5224  9.03433  4.36158  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.4582  9.17299  5.68972  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.4582  9.17299  5.68972  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.492  9.17299  5.68972  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 699 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.6924  9.17299  5.68972  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.4681  9.17299  5.68972  0.154
protocols.relax.FastRelax: {0} CMD: min  -42.934  9.1649  5.56205  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -42.934  9.1649  5.56205  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.2189  9.1649  5.56205  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 689 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.5324  9.1649  5.56205  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.8671  9.1649  5.56205  0.31955
protocols.relax.FastRelax: {0} CMD: min  -34.5622  9.13355  5.50554  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.5622  9.13355  5.50554  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.4131  9.13355  5.50554  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.8675  9.13355  5.50554  0.55
protocols.relax.FastRelax: {0} CMD: min  -34.8645  8.95653  4.92715  0.55
protocols.relax.FastRelax: {0} MRP: 1  -34.8645  -34.8645  8.95653  4.92715
protocols.relax.FastRelax: {0} CMD: accept_to_best  -34.8645  8.95653  4.92715  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -34.8645  8.95653  4.92715  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.8645  8.95653  4.92715  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.4992  8.95653  4.92715  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 708 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.1604  8.95653  4.92715  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -47.9754  8.95653  4.92715  0.02805
protocols.relax.FastRelax: {0} CMD: min  -56.2751  9.00052  5.47212  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -56.2751  9.00052  5.47212  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -36.6013  9.00052  5.47212  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 675 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -37.1668  9.00052  5.47212  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.8397  9.00052  5.47212  0.154
protocols.relax.FastRelax: {0} CMD: min  -47.1324  8.89118  5.27686  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.1324  8.89118  5.27686  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.5366  8.89118  5.27686  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 664 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.5924  8.89118  5.27686  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.998  8.89118  5.27686  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.1417  8.88481  5.23796  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.1417  8.88481  5.23796  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.694  8.88481  5.23796  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.8016  8.88481  5.23796  0.55
protocols.relax.FastRelax: {0} CMD: min  -36.0651  8.88583  4.82622  0.55
protocols.relax.FastRelax: {0} MRP: 2  -36.0651  -36.0651  8.88583  4.82622
protocols.relax.FastRelax: {0} CMD: accept_to_best  -36.0651  8.88583  4.82622  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -36.0651  8.88583  4.82622  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -36.0651  8.88583  4.82622  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.4788  8.88583  4.82622  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 699 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -49.0418  8.88583  4.82622  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.7682  8.88583  4.82622  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.0949  9.00965  5.09582  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.0949  9.00965  5.09582  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.1563  9.00965  5.09582  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 683 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.083  9.00965  5.09582  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.2441  9.00965  5.09582  0.154
protocols.relax.FastRelax: {0} CMD: min  -47.3649  8.90839  4.99776  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.3649  8.90839  4.99776  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.4087  8.90839  4.99776  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.6  8.90839  4.99776  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.0655  8.90839  4.99776  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.6769  8.87217  4.93805  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.6769  8.87217  4.93805  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.0306  8.87217  4.93805  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 652 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.0442  8.87217  4.93805  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.7361  8.89011  4.83153  0.55
protocols.relax.FastRelax: {0} MRP: 3  -35.7361  -36.0651  8.88583  4.82622
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.7361  8.89011  4.83153  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.7361  8.89011  4.83153  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.7361  8.89011  4.83153  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.4232  8.89011  4.83153  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 696 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -48.9863  8.89011  4.83153  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.7083  8.89011  4.83153  0.02805
protocols.relax.FastRelax: {0} CMD: min  -54.1054  8.99872  5.08389  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -54.1054  8.99872  5.08389  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.7094  8.99872  5.08389  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 667 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.9279  8.99872  5.08389  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.1467  8.99872  5.08389  0.154
protocols.relax.FastRelax: {0} CMD: min  -47.2482  8.89674  5.00861  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.2482  8.89674  5.00861  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -40.1557  8.89674  5.00861  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 659 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.3595  8.89674  5.00861  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.8145  8.89674  5.00861  0.31955
protocols.relax.FastRelax: {0} CMD: min  -40.593  8.86097  4.92478  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.593  8.86097  4.92478  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -32.0237  8.86097  4.92478  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 653 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.0361  8.86097  4.92478  0.55
protocols.relax.FastRelax: {0} CMD: min  -35.7368  8.88913  4.82976  0.55
protocols.relax.FastRelax: {0} MRP: 4  -35.7368  -36.0651  8.88583  4.82622
protocols.relax.FastRelax: {0} CMD: accept_to_best  -35.7368  8.88913  4.82976  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -35.7368  8.88913  4.82976  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_36.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14258.5  5.6887  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14258.5  5.6887  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1938.55  5.6887  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 622 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  63.0482  5.6887  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  66.6501  5.6887  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -21.6403  6.17034  2.15683  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.6403  6.17034  2.15683  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  0.650242  6.17034  2.15683  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 617 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.42392  6.17034  2.15683  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.14733  6.17034  2.15683  0.154
protocols.relax.FastRelax: {0} CMD: min  -17.0684  6.25712  2.53229  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.0684  6.25712  2.53229  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.4626  6.25712  2.53229  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 586 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.6067  6.25712  2.53229  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.93565  6.25712  2.53229  0.31955
protocols.relax.FastRelax: {0} CMD: min  -11.3926  6.14861  2.49638  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.3926  6.14861  2.49638  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.0625  6.14861  2.49638  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 584 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -3.06819  6.14861  2.49638  0.55
protocols.relax.FastRelax: {0} CMD: min  -8.85999  6.65695  3.37871  0.55
protocols.relax.FastRelax: {0} MRP: 0  -8.85999  -8.85999  6.65695  3.37871
protocols.relax.FastRelax: {0} CMD: accept_to_best  -8.85999  6.65695  3.37871  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -8.85999  6.65695  3.37871  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -8.85999  6.65695  3.37871  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.7028  6.65695  3.37871  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 673 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.6228  6.65695  3.37871  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3991  6.65695  3.37871  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.3147  6.7668  3.56294  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.3147  6.7668  3.56294  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.3507  6.7668  3.56294  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 629 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.7005  6.7668  3.56294  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.3404  6.7668  3.56294  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.7326  6.65691  3.48733  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.7326  6.65691  3.48733  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.455  6.65691  3.48733  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7759  6.65691  3.48733  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.1607  6.65691  3.48733  0.31955
protocols.relax.FastRelax: {0} CMD: min  -17.4048  6.6505  3.46862  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.4048  6.6505  3.46862  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.20603  6.6505  3.46862  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 588 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.47248  6.6505  3.46862  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.7611  6.55625  3.35437  0.55
protocols.relax.FastRelax: {0} MRP: 1  -11.7611  -11.7611  6.55625  3.35437
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.7611  6.55625  3.35437  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.7611  6.55625  3.35437  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.7611  6.55625  3.35437  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5666  6.55625  3.35437  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1784  6.55625  3.35437  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9526  6.55625  3.35437  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.1013  6.56298  3.35163  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.1013  6.56298  3.35163  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.459  6.56298  3.35163  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.9548  6.56298  3.35163  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.6958  6.56298  3.35163  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.5609  6.52379  3.30256  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.5609  6.52379  3.30256  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.8295  6.52379  3.30256  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 620 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.4313  6.52379  3.30256  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.8082  6.52379  3.30256  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.077  6.5156  3.30169  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.077  6.5156  3.30169  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.6842  6.5156  3.30169  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 607 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.68578  6.5156  3.30169  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.8005  6.54431  3.34932  0.55
protocols.relax.FastRelax: {0} MRP: 2  -11.8005  -11.8005  6.54431  3.34932
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.8005  6.54431  3.34932  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.8005  6.54431  3.34932  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.8005  6.54431  3.34932  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5776  6.54431  3.34932  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1766  6.54431  3.34932  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9511  6.54431  3.34932  0.02805
protocols.relax.FastRelax: {0} CMD: min  -33.4085  6.53017  3.38486  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4085  6.53017  3.38486  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4517  6.53017  3.38486  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.5938  6.53017  3.38486  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.6244  6.53017  3.38486  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.2059  6.57333  3.35229  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.2059  6.57333  3.35229  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.3427  6.57333  3.35229  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.6092  6.57333  3.35229  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.9621  6.57333  3.35229  0.31955
protocols.relax.FastRelax: {0} CMD: min  -18.1263  6.52617  3.3282  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.1263  6.52617  3.3282  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -10.1744  6.52617  3.3282  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -10.1745  6.52617  3.3282  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.8019  6.54326  3.35141  0.55
protocols.relax.FastRelax: {0} MRP: 3  -11.8019  -11.8019  6.54326  3.35141
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.8019  6.54326  3.35141  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.8019  6.54326  3.35141  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -11.8019  6.54326  3.35141  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.5936  6.54326  3.35141  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 677 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.1906  6.54326  3.35141  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.9645  6.54326  3.35141  0.02805
protocols.relax.FastRelax: {0} CMD: min  -33.4849  6.53148  3.38659  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -33.4849  6.53148  3.38659  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.1664  6.53148  3.38659  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 633 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.3057  6.53148  3.38659  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.3109  6.53148  3.38659  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.8268  6.55708  3.34394  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.8268  6.55708  3.34394  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.446  6.55708  3.34394  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 621 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.8844  6.55708  3.34394  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.2798  6.55708  3.34394  0.31955
protocols.relax.FastRelax: {0} CMD: min  -17.5866  6.52758  3.33916  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.5866  6.52758  3.33916  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.83893  6.52758  3.33916  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.85134  6.52758  3.33916  0.55
protocols.relax.FastRelax: {0} CMD: min  -11.8064  6.54225  3.35152  0.55
protocols.relax.FastRelax: {0} MRP: 4  -11.8064  -11.8064  6.54225  3.35152
protocols.relax.FastRelax: {0} CMD: accept_to_best  -11.8064  6.54225  3.35152  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -11.8064  6.54225  3.35152  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_0.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14084.3  5.31796  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14084.3  5.31796  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2267.32  5.31796  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 639 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  64.4213  5.31796  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  68.0917  5.31796  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  42.3775  5.20094  1.61667  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  42.3775  5.20094  1.61667  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  94.5014  5.20094  1.61667  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 570 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  57.1387  5.20094  1.61667  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  58.343  5.20094  1.61667  0.154
protocols.relax.FastRelax: {0} CMD: min  -5.39499  7.88237  6.50118  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -5.39499  7.88237  6.50118  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.20612  7.88237  6.50118  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 599 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  1.062  7.88237  6.50118  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.6225  7.88237  6.50118  0.31955
protocols.relax.FastRelax: {0} CMD: min  -5.52714  9.87503  8.93616  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -5.52714  9.87503  8.93616  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.02616  9.87503  8.93616  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 601 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  0.480936  9.87503  8.93616  0.55
protocols.relax.FastRelax: {0} CMD: min  -9.13554  10.0236  9.07356  0.55
protocols.relax.FastRelax: {0} MRP: 0  -9.13554  -9.13554  10.0236  9.07356
protocols.relax.FastRelax: {0} CMD: accept_to_best  -9.13554  10.0236  9.07356  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -9.13554  10.0236  9.07356  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -9.13554  10.0236  9.07356  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.0783  10.0236  9.07356  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 664 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.2204  10.0236  9.07356  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.956  10.0236  9.07356  0.02805
protocols.relax.FastRelax: {0} CMD: min  -27.2371  9.82105  8.83117  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.2371  9.82105  8.83117  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.03242  9.82105  8.83117  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 697 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.78933  9.82105  8.83117  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.58542  9.82105  8.83117  0.154
protocols.relax.FastRelax: {0} CMD: min  -21.4338  9.96163  9.0156  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.4338  9.96163  9.0156  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.1418  9.96163  9.0156  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 630 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.1719  9.96163  9.0156  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.678  9.96163  9.0156  0.31955
protocols.relax.FastRelax: {0} CMD: min  -14.9838  9.98719  9.04428  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.9838  9.98719  9.04428  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.14143  9.98719  9.04428  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 625 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -6.18448  9.98719  9.04428  0.55
protocols.relax.FastRelax: {0} CMD: min  -15.0527  10.4884  9.65999  0.55
protocols.relax.FastRelax: {0} MRP: 1  -15.0527  -15.0527  10.4884  9.65999
protocols.relax.FastRelax: {0} CMD: accept_to_best  -15.0527  10.4884  9.65999  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -15.0527  10.4884  9.65999  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.0527  10.4884  9.65999  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.2527  10.4884  9.65999  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 812 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.1276  10.4884  9.65999  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.8767  10.4884  9.65999  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.6625  10.5302  9.73849  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.6625  10.5302  9.73849  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5803  10.5302  9.73849  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 864 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.1797  10.5302  9.73849  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.4136  10.5302  9.73849  0.154
protocols.relax.FastRelax: {0} CMD: min  -29.2091  10.299  9.48105  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -29.2091  10.299  9.48105  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.2524  10.299  9.48105  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 833 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.2738  10.299  9.48105  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.7273  10.299  9.48105  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.8663  10.3094  9.49346  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.8663  10.3094  9.49346  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.6927  10.3094  9.49346  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 792 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -11.8777  10.3094  9.49346  0.55
protocols.relax.FastRelax: {0} CMD: min  -19.6511  9.40149  8.34333  0.55
protocols.relax.FastRelax: {0} MRP: 2  -19.6511  -19.6511  9.40149  8.34333
protocols.relax.FastRelax: {0} CMD: accept_to_best  -19.6511  9.40149  8.34333  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -19.6511  9.40149  8.34333  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.6511  9.40149  8.34333  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.1684  9.40149  8.34333  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 904 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.3839  9.40149  8.34333  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.723  9.40149  8.34333  0.02805
protocols.relax.FastRelax: {0} CMD: min  -41.998  9.56214  8.57722  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.998  9.56214  8.57722  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7475  9.56214  8.57722  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 886 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -21.837  9.56214  8.57722  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -20.5487  9.56214  8.57722  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.9442  9.43468  8.4136  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.9442  9.43468  8.4136  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2521  9.43468  8.4136  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 758 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.2558  9.43468  8.4136  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.6508  9.43468  8.4136  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.1242  9.44081  8.41781  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.1242  9.44081  8.41781  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.3672  9.44081  8.41781  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 719 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.5063  9.44081  8.41781  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.6964  9.30078  8.1969  0.55
protocols.relax.FastRelax: {0} MRP: 3  -20.6964  -20.6964  9.30078  8.1969
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.6964  9.30078  8.1969  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.6964  9.30078  8.1969  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -20.6964  9.30078  8.1969  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.5492  9.30078  8.1969  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 791 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.6324  9.30078  8.1969  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.9623  9.30078  8.1969  0.02805
protocols.relax.FastRelax: {0} CMD: min  -38.4091  9.42  8.37952  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -38.4091  9.42  8.37952  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.4168  9.42  8.37952  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 855 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.9004  9.42  8.37952  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.1369  9.42  8.37952  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.1988  9.39661  8.32953  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.1988  9.39661  8.32953  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.8508  9.39661  8.32953  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 755 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.9323  9.39661  8.32953  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.4412  9.39661  8.32953  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.8836  9.40197  8.33344  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.8836  9.40197  8.33344  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.2548  9.40197  8.33344  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 706 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.271  9.40197  8.33344  0.55
protocols.relax.FastRelax: {0} CMD: min  -20.7745  9.29643  8.18653  0.55
protocols.relax.FastRelax: {0} MRP: 4  -20.7745  -20.7745  9.29643  8.18653
protocols.relax.FastRelax: {0} CMD: accept_to_best  -20.7745  9.29643  8.18653  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -20.7745  9.29643  8.18653  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_41.pdb
protocols.relax.FastRelax: {0} CMD: repeat  16069.5  8.43767  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  16069.5  8.43767  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2069.84  8.43767  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 632 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  100.5  8.43767  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  113.644  8.43767  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -18.7319  10.136  6.13807  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.7319  10.136  6.13807  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8.19352  10.136  6.13807  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 652 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  5.93072  10.136  6.13807  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7.7696  10.136  6.13807  0.154
protocols.relax.FastRelax: {0} CMD: min  -18.1199  8.92187  5.64819  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.1199  8.92187  5.64819  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.80326  8.92187  5.64819  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.0221  8.92187  5.64819  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.3061  8.92187  5.64819  0.31955
protocols.relax.FastRelax: {0} CMD: min  -19.3907  8.71445  6.34154  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.3907  8.71445  6.34154  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.978  8.71445  6.34154  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 617 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.2433  8.71445  6.34154  0.55
protocols.relax.FastRelax: {0} CMD: min  -17.2352  7.76336  5.13682  0.55
protocols.relax.FastRelax: {0} MRP: 0  -17.2352  -17.2352  7.76336  5.13682
protocols.relax.FastRelax: {0} CMD: accept_to_best  -17.2352  7.76336  5.13682  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -17.2352  7.76336  5.13682  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -17.2352  7.76336  5.13682  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.9966  7.76336  5.13682  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 643 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.708  7.76336  5.13682  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.533  7.76336  5.13682  0.02805
protocols.relax.FastRelax: {0} CMD: min  -34.4237  7.85069  5.20119  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.4237  7.85069  5.20119  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6584  7.85069  5.20119  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 619 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.8143  7.85069  5.20119  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.34  7.85069  5.20119  0.154
protocols.relax.FastRelax: {0} CMD: min  -27.4788  7.84934  5.20322  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -27.4788  7.84934  5.20322  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.895  7.84934  5.20322  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 608 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.8723  7.84934  5.20322  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.3346  7.84934  5.20322  0.31955
protocols.relax.FastRelax: {0} CMD: min  -21.7201  7.867  5.26965  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.7201  7.867  5.26965  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.6212  7.867  5.26965  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -14.6887  7.867  5.26965  0.55
protocols.relax.FastRelax: {0} CMD: min  -18.0589  7.97258  5.17243  0.55
protocols.relax.FastRelax: {0} MRP: 1  -18.0589  -18.0589  7.97258  5.17243
protocols.relax.FastRelax: {0} CMD: accept_to_best  -18.0589  7.97258  5.17243  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -18.0589  7.97258  5.17243  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.0589  7.97258  5.17243  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.9102  7.97258  5.17243  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.6089  7.97258  5.17243  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.4151  7.97258  5.17243  0.02805
protocols.relax.FastRelax: {0} CMD: min  -35.8712  7.90262  5.23429  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -35.8712  7.90262  5.23429  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.2482  7.90262  5.23429  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 634 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.7262  7.90262  5.23429  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.0816  7.90262  5.23429  0.154
protocols.relax.FastRelax: {0} CMD: min  -30.1416  7.83094  5.38596  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.1416  7.83094  5.38596  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.0791  7.83094  5.38596  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 606 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.1521  7.83094  5.38596  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.5953  7.83094  5.38596  0.31955
protocols.relax.FastRelax: {0} CMD: min  -23.9399  7.81749  5.42235  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -23.9399  7.81749  5.42235  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.3174  7.81749  5.42235  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 599 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.3174  7.81749  5.42235  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.5406  7.9128  5.92056  0.55
protocols.relax.FastRelax: {0} MRP: 2  -21.5406  -21.5406  7.9128  5.92056
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.5406  7.9128  5.92056  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.5406  7.9128  5.92056  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.5406  7.9128  5.92056  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.8528  7.9128  5.92056  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 678 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.4439  7.9128  5.92056  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.2582  7.9128  5.92056  0.02805
protocols.relax.FastRelax: {0} CMD: min  -41.2998  8.0039  5.85023  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -41.2998  8.0039  5.85023  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.7063  8.0039  5.85023  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 624 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.0949  8.0039  5.85023  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -26.2251  8.0039  5.85023  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.2379  7.96985  5.84307  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.2379  7.96985  5.84307  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.8688  7.96985  5.84307  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 618 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.8923  7.96985  5.84307  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.3194  7.96985  5.84307  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.0766  7.95469  5.85949  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.0766  7.95469  5.85949  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.9076  7.95469  5.85949  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 610 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.9076  7.95469  5.85949  0.55
protocols.relax.FastRelax: {0} CMD: min  -21.134  7.85211  5.66634  0.55
protocols.relax.FastRelax: {0} MRP: 3  -21.134  -21.5406  7.9128  5.92056
protocols.relax.FastRelax: {0} CMD: accept_to_best  -21.134  7.85211  5.66634  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -21.134  7.85211  5.66634  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.134  7.85211  5.66634  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -34.6099  7.85211  5.66634  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 676 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -36.1629  7.85211  5.66634  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.8376  7.85211  5.66634  0.02805
protocols.relax.FastRelax: {0} CMD: min  -40.2103  7.84265  5.71217  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.2103  7.84265  5.71217  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.158  7.84265  5.71217  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 622 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.6988  7.84265  5.71217  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.0259  7.84265  5.71217  0.154
protocols.relax.FastRelax: {0} CMD: min  -32.7432  7.84182  5.72476  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.7432  7.84182  5.72476  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.7413  7.84182  5.72476  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 613 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -24.7966  7.84182  5.72476  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.1769  7.84182  5.72476  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.9244  7.82047  5.73843  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.9244  7.82047  5.73843  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.2871  7.82047  5.73843  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 604 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.2882  7.82047  5.73843  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.0502  7.84971  5.65448  0.55
protocols.relax.FastRelax: {0} MRP: 4  -22.0502  -22.0502  7.84971  5.65448
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.0502  7.84971  5.65448  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.0502  7.84971  5.65448  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_16.pdb
protocols.relax.FastRelax: {0} CMD: repeat  15214.7  6.60983  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  15214.7  6.60983  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2487.43  6.60983  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 695 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  91.3799  6.60983  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  99.049  6.60983  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -12.1053  7.19244  5.77919  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -12.1053  7.19244  5.77919  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  15.083  7.19244  5.77919  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 703 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  1.07923  7.19244  5.77919  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2.35809  7.19244  5.77919  0.154
protocols.relax.FastRelax: {0} CMD: min  -15.8682  7.24944  5.91065  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -15.8682  7.24944  5.91065  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.53444  7.24944  5.91065  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 673 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -7.10523  7.24944  5.91065  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.37542  7.24944  5.91065  0.31955
protocols.relax.FastRelax: {0} CMD: min  -7.4871  7.22459  5.86522  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -7.4871  7.22459  5.86522  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  3.68512  7.22459  5.86522  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  3.68437  7.22459  5.86522  0.55
protocols.relax.FastRelax: {0} CMD: min  -4.91223  7.38442  6.56804  0.55
protocols.relax.FastRelax: {0} MRP: 0  -4.91223  -4.91223  7.38442  6.56804
protocols.relax.FastRelax: {0} CMD: accept_to_best  -4.91223  7.38442  6.56804  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -4.91223  7.38442  6.56804  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -4.91223  7.38442  6.56804  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.4307  7.38442  6.56804  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 715 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.029  7.38442  6.56804  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -21.6768  7.38442  6.56804  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.2136  7.7855  7.19772  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.2136  7.7855  7.19772  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -6.85565  7.7855  7.19772  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 680 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.26103  7.7855  7.19772  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -7.79579  7.7855  7.19772  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.233  7.83367  7.25037  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.233  7.83367  7.25037  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.0011  7.83367  7.25037  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.1192  7.83367  7.25037  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -14.3902  7.83367  7.25037  0.31955
protocols.relax.FastRelax: {0} CMD: min  -14.8536  7.828  7.24023  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -14.8536  7.828  7.24023  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -1.69784  7.828  7.24023  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 670 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -1.7008  7.828  7.24023  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.8315  7.82347  7.24542  0.55
protocols.relax.FastRelax: {0} MRP: 1  -10.8315  -10.8315  7.82347  7.24542
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.8315  7.82347  7.24542  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.8315  7.82347  7.24542  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.8315  7.82347  7.24542  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.1569  7.82347  7.24542  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 735 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -27.6144  7.82347  7.24542  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.4008  7.82347  7.24542  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.2411  8.16501  7.89546  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.2411  8.16501  7.89546  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.6277  8.16501  7.89546  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 703 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -18.9178  8.16501  7.89546  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.6531  8.16501  7.89546  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.3135  8.0289  7.63418  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.3135  8.0289  7.63418  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.7571  8.0289  7.63418  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 698 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.7573  8.0289  7.63418  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.0037  8.0289  7.63418  0.31955
protocols.relax.FastRelax: {0} CMD: min  -18.5971  7.94478  7.47329  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.5971  7.94478  7.47329  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.77212  7.94478  7.47329  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.77676  7.94478  7.47329  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.8972  7.74671  7.07784  0.55
protocols.relax.FastRelax: {0} MRP: 2  -10.8972  -10.8972  7.74671  7.07784
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.8972  7.74671  7.07784  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.8972  7.74671  7.07784  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.8972  7.74671  7.07784  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.6842  7.74671  7.07784  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 727 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.1211  7.74671  7.07784  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.902  7.74671  7.07784  0.02805
protocols.relax.FastRelax: {0} CMD: min  -37.2651  8.10293  7.77676  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -37.2651  8.10293  7.77676  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.3041  8.10293  7.77676  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 700 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -17.6574  8.10293  7.77676  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.2979  8.10293  7.77676  0.154
protocols.relax.FastRelax: {0} CMD: min  -26.5038  7.99499  7.54656  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -26.5038  7.99499  7.54656  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.9765  7.99499  7.54656  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 695 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.9808  7.99499  7.54656  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.2319  7.99499  7.54656  0.31955
protocols.relax.FastRelax: {0} CMD: min  -16.8736  7.96545  7.47142  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -16.8736  7.96545  7.47142  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -4.14919  7.96545  7.47142  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -4.16399  7.96545  7.47142  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.8934  7.74381  7.07715  0.55
protocols.relax.FastRelax: {0} MRP: 3  -10.8934  -10.8972  7.74671  7.07784
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.8934  7.74381  7.07715  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.8934  7.74381  7.07715  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -10.8934  7.74381  7.07715  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.674  7.74381  7.07715  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 726 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.1215  7.74381  7.07715  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -27.9023  7.74381  7.07715  0.02805
protocols.relax.FastRelax: {0} CMD: min  -31.2105  7.84642  7.35285  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -31.2105  7.84642  7.35285  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.4832  7.84642  7.35285  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 716 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.6488  7.84642  7.35285  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.8791  7.84642  7.35285  0.154
protocols.relax.FastRelax: {0} CMD: min  -24.396  7.86294  7.30912  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -24.396  7.86294  7.30912  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.4805  7.86294  7.30912  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 693 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.7085  7.86294  7.30912  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -15.0043  7.86294  7.30912  0.31955
protocols.relax.FastRelax: {0} CMD: min  -18.1393  7.83399  7.20924  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.1393  7.83399  7.20924  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -8.75668  7.83399  7.20924  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -8.76251  7.83399  7.20924  0.55
protocols.relax.FastRelax: {0} CMD: min  -10.9037  7.73882  7.06792  0.55
protocols.relax.FastRelax: {0} MRP: 4  -10.9037  -10.9037  7.73882  7.06792
protocols.relax.FastRelax: {0} CMD: accept_to_best  -10.9037  7.73882  7.06792  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -10.9037  7.73882  7.06792  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/random/decoy_28.pdb
protocols.relax.FastRelax: {0} CMD: repeat  14909.6  5.2511  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  14909.6  5.2511  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2276.77  5.2511  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 589 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  69.9648  5.2511  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  75.7873  5.2511  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  8.92555  6.97979  8.94594  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  8.92555  6.97979  8.94594  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  155.579  6.97979  8.94594  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 656 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  8.7689  6.97979  8.94594  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  10.6242  6.97979  8.94594  0.154
protocols.relax.FastRelax: {0} CMD: min  -21.717  6.31672  8.06875  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -21.717  6.31672  8.06875  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.5026  6.31672  8.06875  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 635 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.8428  6.31672  8.06875  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.1234  6.31672  8.06875  0.31955
protocols.relax.FastRelax: {0} CMD: min  -13.9224  6.32076  8.05597  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -13.9224  6.32076  8.05597  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.87683  6.32076  8.05597  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 636 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -3.67985  6.32076  8.05597  0.55
protocols.relax.FastRelax: {0} CMD: min  -18.7185  8.21549  9.9897  0.55
protocols.relax.FastRelax: {0} MRP: 0  -18.7185  -18.7185  8.21549  9.9897
protocols.relax.FastRelax: {0} CMD: accept_to_best  -18.7185  8.21549  9.9897  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -18.7185  8.21549  9.9897  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -18.7185  8.21549  9.9897  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -33.9221  8.21549  9.9897  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -35.8714  8.21549  9.9897  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.44  8.21549  9.9897  0.02805
protocols.relax.FastRelax: {0} CMD: min  -47.1312  8.34459  10.2019  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -47.1312  8.34459  10.2019  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.0208  8.34459  10.2019  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 651 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.2635  8.34459  10.2019  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.9255  8.34459  10.2019  0.154
protocols.relax.FastRelax: {0} CMD: min  -34.5635  8.45697  10.2564  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -34.5635  8.45697  10.2564  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.6654  8.45697  10.2564  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 669 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.6654  8.45697  10.2564  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.9638  8.45697  10.2564  0.31955
protocols.relax.FastRelax: {0} CMD: min  -25.4713  8.42376  10.211  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.4713  8.42376  10.211  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -12.9102  8.42376  10.211  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 662 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -12.9133  8.42376  10.211  0.55
protocols.relax.FastRelax: {0} CMD: min  -22.7653  8.95125  10.5149  0.55
protocols.relax.FastRelax: {0} MRP: 1  -22.7653  -22.7653  8.95125  10.5149
protocols.relax.FastRelax: {0} CMD: accept_to_best  -22.7653  8.95125  10.5149  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -22.7653  8.95125  10.5149  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -22.7653  8.95125  10.5149  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.0965  8.95125  10.5149  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 688 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.2755  8.95125  10.5149  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.5853  8.95125  10.5149  0.02805
protocols.relax.FastRelax: {0} CMD: min  -45.2772  8.95467  10.5239  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -45.2772  8.95467  10.5239  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.0195  8.95467  10.5239  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 679 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -13.9492  8.95467  10.5239  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -11.803  8.95467  10.5239  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.0851  8.98017  10.5592  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.0851  8.98017  10.5592  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.051  8.98017  10.5592  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 668 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -31.0586  8.98017  10.5592  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.4257  8.98017  10.5592  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.8194  8.97954  10.5575  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.8194  8.97954  10.5575  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -19.3361  8.97954  10.5575  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 658 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -19.3376  8.97954  10.5575  0.55
protocols.relax.FastRelax: {0} CMD: min  -25.7363  8.91822  10.4836  0.55
protocols.relax.FastRelax: {0} MRP: 2  -25.7363  -25.7363  8.91822  10.4836
protocols.relax.FastRelax: {0} CMD: accept_to_best  -25.7363  8.91822  10.4836  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -25.7363  8.91822  10.4836  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7363  8.91822  10.4836  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.6226  8.91822  10.4836  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 683 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.9108  8.91822  10.4836  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.539  8.91822  10.4836  0.02805
protocols.relax.FastRelax: {0} CMD: min  -49.5888  9.00954  10.5785  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.5888  9.00954  10.5785  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.2588  9.00954  10.5785  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 672 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -26.7271  9.00954  10.5785  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -25.1776  9.00954  10.5785  0.154
protocols.relax.FastRelax: {0} CMD: min  -39.304  8.95942  10.5504  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -39.304  8.95942  10.5504  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.5621  8.95942  10.5504  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -29.5623  8.95942  10.5504  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -28.7941  8.95942  10.5504  0.31955
protocols.relax.FastRelax: {0} CMD: min  -32.1425  8.96291  10.5534  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -32.1425  8.96291  10.5534  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -22.0725  8.96291  10.5534  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 660 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -22.0731  8.96291  10.5534  0.55
protocols.relax.FastRelax: {0} CMD: min  -25.7374  8.92187  10.4853  0.55
protocols.relax.FastRelax: {0} MRP: 3  -25.7374  -25.7374  8.92187  10.4853
protocols.relax.FastRelax: {0} CMD: accept_to_best  -25.7374  8.92187  10.4853  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -25.7374  8.92187  10.4853  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -25.7374  8.92187  10.4853  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -41.6181  8.92187  10.4853  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 683 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -42.9412  8.92187  10.4853  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.5731  8.92187  10.4853  0.02805
protocols.relax.FastRelax: {0} CMD: min  -52.4518  9.17264  10.7754  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -52.4518  9.17264  10.7754  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -24.1735  9.17264  10.7754  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 673 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -25.3783  9.17264  10.7754  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -23.5531  9.17264  10.7754  0.154
protocols.relax.FastRelax: {0} CMD: min  -40.3612  9.0718  10.6697  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.3612  9.0718  10.6697  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.7705  9.0718  10.6697  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 666 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -30.7708  9.0718  10.6697  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.0147  9.0718  10.6697  0.31955
protocols.relax.FastRelax: {0} CMD: min  -30.3885  9.05803  10.6499  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -30.3885  9.05803  10.6499  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.6698  9.05803  10.6499  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 661 rotamers at 50 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -16.6713  9.05803  10.6499  0.55
protocols.relax.FastRelax: {0} CMD: min  -25.7374  8.92671  10.4892  0.55
protocols.relax.FastRelax: {0} MRP: 4  -25.7374  -25.7374  8.92187  10.4853
protocols.relax.FastRelax: {0} CMD: accept_to_best  -25.7374  8.92671  10.4892  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -25.7374  8.92671  10.4892  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax

Evaluating the folding results by getting the energies and RMSDs (distnace from the native pose) of each one of the predicted structures

In [28]:
decoy_poses = [prs.pose_from_pdb(f) for f in glob.glob(job_output + '*.pdb')]

core.import_pose.import_pose: {0} File 'outputs/random/decoy_41.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_1.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_37.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_13.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_5.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_33.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_39.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_9.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_47.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_11.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_32.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_26.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_4.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_49.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_40.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_10.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_43.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_35.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_21.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_14.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_7.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_6.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_2.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_24.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_8.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_42.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_20.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_17.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_25.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_22.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_44.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_34.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_45.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_3.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_23.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_38.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_16.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_18.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_28.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_48.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_15.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_46.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_30.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_19.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_27.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_0.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_36.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_29.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_31.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/random/decoy_12.pdb' automatically determined to be of type PDB
In [29]:
data = []
for i in range(1, len(decoy_poses)):  # print out the job scores
    data.append({'structure': decoy_poses[i].pdb_info().name(), 
                      'energy_score': scores[i]})
In [30]:
df = pd.DataFrame(data)
In [32]:
df.sort_values('energy_score')
Out[32]:
energy_score structure
27 -53.142294 outputs/random/decoy_25.pdb
30 -43.733361 outputs/random/decoy_34.pdb
17 -41.937664 outputs/random/decoy_21.pdb
32 -40.823222 outputs/random/decoy_3.pdb
11 -37.932157 outputs/random/decoy_4.pdb
44 -36.065080 outputs/random/decoy_0.pdb
33 -35.992126 outputs/random/decoy_23.pdb
7 -35.778544 outputs/random/decoy_47.pdb
20 -35.560202 outputs/random/decoy_6.pdb
4 -35.254630 outputs/random/decoy_33.pdb
3 -33.489562 outputs/random/decoy_5.pdb
13 -32.656341 outputs/random/decoy_40.pdb
18 -32.326720 outputs/random/decoy_14.pdb
41 -31.407290 outputs/random/decoy_30.pdb
37 -30.317749 outputs/random/decoy_28.pdb
39 -29.727147 outputs/random/decoy_15.pdb
26 -28.268543 outputs/random/decoy_17.pdb
8 -28.057287 outputs/random/decoy_11.pdb
38 -27.768231 outputs/random/decoy_48.pdb
16 -26.316974 outputs/random/decoy_35.pdb
9 -24.760832 outputs/random/decoy_32.pdb
19 -23.458524 outputs/random/decoy_7.pdb
36 -22.270473 outputs/random/decoy_18.pdb
28 -22.057972 outputs/random/decoy_22.pdb
47 -22.050172 outputs/random/decoy_31.pdb
15 -21.305154 outputs/random/decoy_43.pdb
24 -21.269224 outputs/random/decoy_42.pdb
34 -20.997539 outputs/random/decoy_38.pdb
46 -20.774485 outputs/random/decoy_29.pdb
10 -20.220729 outputs/random/decoy_26.pdb
31 -20.105875 outputs/random/decoy_45.pdb
2 -19.838025 outputs/random/decoy_13.pdb
23 -19.291712 outputs/random/decoy_8.pdb
25 -17.692451 outputs/random/decoy_20.pdb
12 -17.640500 outputs/random/decoy_49.pdb
43 -16.670767 outputs/random/decoy_27.pdb
6 -16.458693 outputs/random/decoy_9.pdb
1 -15.520654 outputs/random/decoy_37.pdb
42 -14.882271 outputs/random/decoy_19.pdb
40 -14.865020 outputs/random/decoy_46.pdb
22 -13.519384 outputs/random/decoy_24.pdb
0 -13.025488 outputs/random/decoy_1.pdb
5 -12.539581 outputs/random/decoy_39.pdb
45 -11.806401 outputs/random/decoy_36.pdb
48 -10.903713 outputs/random/decoy_12.pdb
21 -9.384103 outputs/random/decoy_2.pdb
35 -6.933988 outputs/random/decoy_16.pdb
29 -2.476696 outputs/random/decoy_44.pdb
14 3.789485 outputs/random/decoy_10.pdb

Q: Plot the energy_score VS rmsd. Are the lowest energy structures the closest to the native one?

In [58]:
import matplotlib.pyplot as plt

plt.scatter(rmsd_df["energy_score"], rmsd_df["rmsd"])
plt.xlabel("energy_score")
plt.ylabel("rmsd")
plt.show()
In [ ]: